![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
Previous version:
v3.0
v4.0
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc11g006720.1.1 | ||||||||
Common Name | LOC101262372 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 211aa MW: 24593.6 Da PI: 6.9617 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 31.3 | 4.6e-10 | 23 | 66 | 3 | 44 |
SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44 WT Ed+l+ +a ++ + +W +Ia++++ gRt++++ ++ Solyc11g006720.1.1 23 TWTRFEDKLFEQALVMYSENdieRWQKIANHVP-GRTPEDVMAHY 66 7********************************.********998 PP | |||||||
2 | Myb_DNA-binding | 44.4 | 3.9e-14 | 119 | 163 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ l++ + ++G+g+W++I+r + +Rt+ q+ s+ qky Solyc11g006720.1.1 119 PWTEEEHRLFLIGLDKYGKGDWRSISRNVVVTRTPTQVASHAQKY 163 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 1.66E-12 | 18 | 70 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51293 | 8.745 | 19 | 73 | IPR017884 | SANT domain |
SMART | SM00717 | 9.3E-9 | 20 | 72 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.16E-8 | 23 | 66 | No hit | No description |
Pfam | PF00249 | 2.1E-8 | 23 | 66 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.0E-7 | 23 | 70 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 21.268 | 112 | 168 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.87E-17 | 114 | 169 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 7.1E-17 | 115 | 167 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 7.3E-11 | 116 | 166 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.3E-11 | 116 | 162 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 4.3E-12 | 119 | 163 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.87E-9 | 119 | 163 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 211 aa Download sequence Send to blast |
MMYPANNRWL IGESPAMIHP NSTWTRFEDK LFEQALVMYS ENDIERWQKI ANHVPGRTPE 60 DVMAHYDALV HDVFEIDSGR VEPPSYPDDL FDWESDCKTN QISFGTNKKH EVERKKGTPW 120 TEEEHRLFLI GLDKYGKGDW RSISRNVVVT RTPTQVASHA QKYYLRQQSM KKERKRSSIH 180 DITTAVDTKM VPPQNCLQNQ GGYQNFNFPM * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 5e-13 | 24 | 86 | 11 | 73 | RADIALIS |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Les.4895 | 0.0 | flower| fruit| root |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young seedlings, developing leaves, sepals and trichomes. {ECO:0000269|PubMed:26243618}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00055 | PBM | Transfer from AT5G04760 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc11g006720.1.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT012856 | 0.0 | Lycopersicon esculentum clone 113942F, mRNA sequence |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004249950.1 | 1e-160 | transcription factor SRM1 | ||||
Swissprot | Q9FNN6 | 4e-56 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | A0A3Q7JHW8 | 1e-159 | A0A3Q7JHW8_SOLLC; Uncharacterized protein | ||||
STRING | Solyc11g006720.1.1 | 1e-160 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA4547 | 22 | 41 | Representative plant | OGRP275 | 17 | 122 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04760.1 | 4e-71 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc11g006720.1.1 |
Entrez Gene | 101262372 |
Publications ? help Back to Top | |||
---|---|---|---|
|