PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc10g086530.1.1
Common NameLOC101247176
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 762aa    MW: 86537.4 Da    PI: 6.1661
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc10g086530.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS370.91.7e-1133877591374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++lL++cA+av+++d + a++lL++++ ++sp gd +qRla++f+ +L+arla+++s++ykal  ++ts    ++ l+a++l+   +P+ 
  Solyc10g086530.1.1 387 LRSLLINCAQAVAADDCRSATELLKQVRLHSSPFGDGNQRLAHCFADGLEARLAGTGSQIYKALVNKRTS---AADFLKAYHLYLASCPFR 474
                         689*************************************************************999998...9***************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         k+s +t N++I +  ++++rvHiiDf+i +G+QWp+L+q +a+R++gpp+lRiTg++ p++g   +e++eetg+rL+++A++++vpfe+++
  Solyc10g086530.1.1 475 KISGFTSNKTIIRKSKHATRVHIIDFGILYGFQWPTLIQRIAAREGGPPNLRITGIEFPQPGfrPAERIEETGRRLSDYAKSFNVPFEYQA 565
                         *************************************************************9***************************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          +ak++e++++e+L+++++E l+Vn+ ++ ++l+de+v ++s r+ vL+l+++++P+++++   +  ++++ F++rf e l ++salfd+l
  Solyc10g086530.1.1 566 -IAKKWETIRVEDLKLEKDEYLVVNCLYRFKNLHDETVLSDSSRTLVLNLIREINPDIFIHGIVNGAYSAPFFVTRFREVLFHFSALFDML 655
                         .7***************************************************************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplseka.akqaklllrkvksdgyrveeesgslvlg 361
                         ea++pre  er  +Ere++gre+ nv+aceg er+er et+++W+ r  +a F++ p+++++ ++ a   +r+ + + + +++++++++lg
  Solyc10g086530.1.1 656 EANVPREFPERLLIEREIFGREALNVIACEGWERVERPETYKQWQVRHLRARFTQTPFEQEEiMNMAVKKVRTSYHKDFIIDQDNKWMLLG 746
                         **********************************************************98761555566777777888************* PP

                GRAS 362 WkdrpLvsvSaWr 374
                         Wk+r+++++S+W+
  Solyc10g086530.1.1 747 WKGRTIYALSCWT 759
                         ************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.721361738IPR005202Transcription factor GRAS
PfamPF035145.9E-111387759IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 762 aa     Download sequence    Send to blast
MDPRFNRFPT TVNGFNLENQ SLLSFSDNWK NNEPIIGAIY PDQKIVNAPT FENSFIQQTV  60
PSLSNDPSTT SNIALTSEMG TEDEYNEDFD FSDTVLSYIN QMLMEEDMED KTHMLHESLE  120
LQAKERSFYE ALGKKYPPSP HQNLAITEQN GEIPEDYYSA SLYSSTSNVI DTSGYLIDPS  180
ISNDHNYSYE QGLFICNGPY SSISSSNSIN NLGDGFLDSP VSPLHIPDIY NDSHPIWKFR  240
KGVEEASKFL PTYSKLLDNV VINDLLPQAK RGESGCAAAQ VEKRDVGATS PTGPRGTKNP  300
HRDDRDSEEE EERRSKQAAV YAESTVRSDE FDVILLHSMG DGREALTAYR ESLKNARTKP  360
TVQSKGFAVG RGGRGKKQSG KKEVIDLRSL LINCAQAVAA DDCRSATELL KQVRLHSSPF  420
GDGNQRLAHC FADGLEARLA GTGSQIYKAL VNKRTSAADF LKAYHLYLAS CPFRKISGFT  480
SNKTIIRKSK HATRVHIIDF GILYGFQWPT LIQRIAAREG GPPNLRITGI EFPQPGFRPA  540
ERIEETGRRL SDYAKSFNVP FEYQAIAKKW ETIRVEDLKL EKDEYLVVNC LYRFKNLHDE  600
TVLSDSSRTL VLNLIREINP DIFIHGIVNG AYSAPFFVTR FREVLFHFSA LFDMLEANVP  660
REFPERLLIE REIFGREALN VIACEGWERV ERPETYKQWQ VRHLRARFTQ TPFEQEEIMN  720
MAVKKVRTSY HKDFIIDQDN KWMLLGWKGR TIYALSCWTP I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A4e-483767608380Protein SCARECROW
5b3h_A4e-483767607379Protein SCARECROW
5b3h_D4e-483767607379Protein SCARECROW
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in cotyledons, leaves and flowers, and in the elongation zone in root. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc10g086530.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010312352.10.0scarecrow-like protein 9
RefseqXP_010312353.10.0scarecrow-like protein 9
SwissprotO809330.0SCL9_ARATH; Scarecrow-like protein 9
TrEMBLA0A3Q7JH660.0A0A3Q7JH66_SOLLC; Uncharacterized protein
STRINGSolyc10g086530.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]