PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc10g076820.1.1
Common NameLOC101251526
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB
Protein Properties Length: 284aa    MW: 32916.8 Da    PI: 9.366
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc10g076820.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.12e-083277346
                        SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                        +WT eE + + da +++ ++   +W  +a++++ g+t ++++  ++ 
  Solyc10g076820.1.1 32 NWTVEENKMFEDALALFDKEtpdRWYNVAAMIP-GKTVNDVIKQYRE 77
                        8*****************99*************.********99986 PP

2Myb_DNA-binding45.61.6e-14152196347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+ +++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
  Solyc10g076820.1.1 152 PWTEEEHRQFLLGLKKYGKGDWRNISRNFVTTRTPTQVASHAQKY 196
                         7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.4352579IPR017877Myb-like domain
SMARTSM007172.9E-102981IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-42979IPR009057Homeodomain-like
SuperFamilySSF466897.1E-123186IPR009057Homeodomain-like
PfamPF002498.0E-73278IPR001005SANT/Myb domain
CDDcd001675.87E-73279No hitNo description
PROSITE profilePS5129418.924145201IPR017930Myb domain
SuperFamilySSF466891.73E-17147200IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-17148200IPR006447Myb domain, plants
SMARTSM007173.2E-12149199IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-12150196IPR009057Homeodomain-like
PfamPF002496.6E-12152196IPR001005SANT/Myb domain
CDDcd001672.17E-10152197No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MSREMGFLSP LPEETTYLRN SNWLFEENKG TNWTVEENKM FEDALALFDK ETPDRWYNVA  60
AMIPGKTVND VIKQYRELVD DVTDIEAGLI PVPASYMTTT SCTTRSFTLD WINHDQEIGA  120
FHDFNKRFHG PSHGKRNTSN RSSEYERKKG IPWTEEEHRQ FLLGLKKYGK GDWRNISRNF  180
VTTRTPTQVA SHAQKYFIRQ ISGGKDKRRS SIHDITTVNL TEMKENHTSS NSPENSVPSP  240
QKQHNLSNQK SYIGFKTYGL KLHQRRMHSV ILQGLQFDQY NTM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A8e-173099876RADIALIS
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Detected in the apical inflorescence meristem, in bract primordia arising in its periphery and in floral meristems produced in the axils of bracts (stages 0-3). From stage 3 to stage 8, detected in all floral organs irrespective of their dorsoventral positions. From stage 9, barely detectable in bracts, sepals, and stamens. In the corolla, however, expression was maintained and enhanced in some regions. Within ventral and lateral petals at stage 9, asymmetric pattern of expression with high levels of transcripts in the inner epidermis of the furrow and very reduced levels in the remaining cell layers. In the dorsal petals, from stage 9 onward, detected but with a more even distribution across cell layers than in the ventral petal. {ECO:0000269|PubMed:11937495}.
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc10g076820.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2402230.0Solanum lycopersicum strain Heinz 1706 chromosome 10 clone sle-56g22 map 10, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004249083.10.0transcription factor DIVARICATA-like isoform X1
SwissprotQ8S9H73e-86DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A3Q7IK010.0A0A3Q7IK01_SOLLC; Uncharacterized protein
STRINGSolyc10g076820.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Representative plantOGRP27517122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-102MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  3. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]