PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc10g005550.1.1 | ||||||||
Common Name | LOC104649494 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 244aa MW: 28037.3 Da PI: 8.3753 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 53.4 | 5.9e-17 | 16 | 63 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+ Ed++l+ ++++G g+W++ ++ g+ R++k+c++rw +yl Solyc10g005550.1.1 16 KGPWTPSEDLKLISFIQKHGHGNWRALPKQAGLLRCGKSCRLRWINYL 63 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 53 | 7.9e-17 | 69 | 114 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T++E++ ++++++ +G++ W++Ia++++ gRt++++k+ w+++l Solyc10g005550.1.1 69 RGNFTPQEEDTIINLHRAFGNR-WSKIASHLP-GRTDNEIKNVWNTHL 114 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.9E-25 | 8 | 66 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 16.23 | 11 | 63 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.12E-31 | 14 | 110 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.2E-14 | 15 | 65 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.3E-16 | 16 | 63 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.90E-10 | 18 | 63 | No hit | No description |
PROSITE profile | PS51294 | 24.949 | 64 | 118 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-27 | 67 | 118 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.3E-15 | 68 | 116 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.0E-15 | 69 | 114 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.35E-10 | 71 | 114 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009809 | Biological Process | lignin biosynthetic process | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:2000652 | Biological Process | regulation of secondary cell wall biogenesis | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 244 aa Download sequence Send to blast |
MGKGRTACCD KSKVKKGPWT PSEDLKLISF IQKHGHGNWR ALPKQAGLLR CGKSCRLRWI 60 NYLRPDVKRG NFTPQEEDTI INLHRAFGNR WSKIASHLPG RTDNEIKNVW NTHLKKRLVV 120 MKKEECKSSS SSTSTSSHQG QYMDNNNNNN SNTLESFSPT SSKANDQVMD FWEYMLDTSS 180 TTTSINNLDH LDSYSKLDIT SEHHPQQLVD EYECQKWLTY LEIELGLTTN NQQEDHQNNF 240 MQL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-27 | 16 | 118 | 7 | 108 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: In nonelongating internodes, highly expressed in interfascicular fibers and xylem cells but not in parenchymatous pith cells. In elongating internodes, predominantly expressed in protoxylem vessels. {ECO:0000269|PubMed:19122102}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in leaves (PubMed:9839469). Specifically expressed in fibers and vessels undergoing secondary wall thickening, especially in inflorescence stems (PubMed:19122102). {ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:9839469}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that binds DNA to the AC cis-elements 5'-ACCTACC-3', 5'-ACCAACC-3' and 5'-ACCTAAC-3' of promoters and specifically activates lignin biosynthetic genes during secondary wall formation mediated by SND1. {ECO:0000269|PubMed:19122102}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00144 | DAP | Transfer from AT1G16490 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc10g005550.1.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by light (PubMed:9839469). Regulated by the SND1 close homologs NST1, NST2, VND6, and VND7 and their downstream targets MYB46 and MYB83 (PubMed:19122102, PubMed:22197883). {ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:22197883, ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC244803 | 0.0 | Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-8f2 map 10, complete sequence | |||
GenBank | AC244937 | 0.0 | Solanum lycopersicum strain Heinz 1706 chromosome 10 clone sle-8f2 map 10, complete sequence |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010327227.1 | 0.0 | transcription factor MYB58 | ||||
Swissprot | Q9SA47 | 1e-77 | MYB58_ARATH; Transcription factor MYB58 | ||||
TrEMBL | M1ASG5 | 1e-161 | M1ASG5_SOLTU; Uncharacterized protein | ||||
STRING | Solyc10g005550.1.1 | 0.0 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G16490.1 | 5e-76 | myb domain protein 58 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc10g005550.1.1 |
Entrez Gene | 104649494 |
Publications ? help Back to Top | |||
---|---|---|---|
|