PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc09g010920.1.1
Common NameLOC101249397
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 762aa    MW: 86040.7 Da    PI: 6.1996
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc09g010920.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS375.38e-1153877591374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++l+++cA+av+++d + a++lL+++++++sp gd +qRla++f+ +L+arla+++s++ykal  ++ts    ++ l+a++l+   sP+ 
  Solyc09g010920.1.1 387 LRTLMINCAQAVAADDSRIANELLKQIRQHSSPFGDGNQRLAHCFADGLEARLAGTGSQIYKALVNKRTS---AADLLKAYHLYLASSPFR 474
                         57899***********************************************************999998...9***************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         k+s ++ N++I+  +e+++rvH+iDf+i +G+QWp+++q +a+R++gpp+lRiTg++ p++g   +e++eetg+rLa++A++++vpfe+++
  Solyc09g010920.1.1 475 KISSFASNKTIMLKAENATRVHVIDFGILYGFQWPTFIQRIAEREGGPPRLRITGIEFPQPGfrPAERIEETGRRLADYARSFNVPFEYHA 565
                         *************************************************************9***************************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          +ak++e++++e+L+++++E laVn+ ++ ++l+de+ ++es r+ vL+lv++++P+++v+   +  ++++ F++rf eal ++salfd l
  Solyc09g010920.1.1 566 -IAKKWESITVEDLKLDKDEFLAVNCLYRFKNLHDETIAVESSRTIVLNLVRKINPDIFVHGIVNGAYSAPFFVTRFREALFHFSALFDIL 655
                         .7***************************************************************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsek.aakqaklllrkvksdgyrveeesgslvlg 361
                         e+ +pre  er+ +Ere++gre+ nv+aceg er+er et+++W++r++ a F+++p++ +  +++a   +r  + + + ++e+s++l+lg
  Solyc09g010920.1.1 656 ETIVPREIPERRLIEREIFGREALNVIACEGWERVERPETYKQWQARIMGARFTQIPFDREeFVNKAIEKVRLGYHRDFVIDEDSQWLLLG 746
                         **********************************************************86515677777888888788************* PP

                GRAS 362 WkdrpLvsvSaWr 374
                         Wk+r+++++S+W+
  Solyc09g010920.1.1 747 WKGRTIYALSCWK 759
                         ************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.222361738IPR005202Transcription factor GRAS
PfamPF035142.8E-112387759IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 762 aa     Download sequence    Send to blast
MDPRFNGHRS SLNNFRFGNQ PLPFSSEQRM INVPRFGLIY SDQNLLNGPR LENNFVQHDF  60
GAVGFISGDH LPTSVESRTD LGVENDFNED IDFSDAVLSY INRMLMEEDM EDKTDMLQES  120
LELQAKEKSL YEALGKKYPP SLEQNVFTVR NSESPDDYVA GSIYNSTSNT GDSSGYLVDP  180
RGVNISTDCN SSYFEGLSFH NTSSLCSSNS GSNVVDGFLD SPVSSFRIPD IYDESRSILN  240
FQKGVEEASK FLPTSNKLLN SIDINGLPSR EPHRQTAYAA AQVEEKDEGE TSPTEGRGKK  300
NPLRGDNNIE EERSSKQAAV FTESTLRSEE FDIVLLNSMG KGGEALEAYQ QNLRNAKSKT  360
TVQISKKSKG GKGRGKKQGG KKEVIDLRTL MINCAQAVAA DDSRIANELL KQIRQHSSPF  420
GDGNQRLAHC FADGLEARLA GTGSQIYKAL VNKRTSAADL LKAYHLYLAS SPFRKISSFA  480
SNKTIMLKAE NATRVHVIDF GILYGFQWPT FIQRIAEREG GPPRLRITGI EFPQPGFRPA  540
ERIEETGRRL ADYARSFNVP FEYHAIAKKW ESITVEDLKL DKDEFLAVNC LYRFKNLHDE  600
TIAVESSRTI VLNLVRKINP DIFVHGIVNG AYSAPFFVTR FREALFHFSA LFDILETIVP  660
REIPERRLIE REIFGREALN VIACEGWERV ERPETYKQWQ ARIMGARFTQ IPFDREEFVN  720
KAIEKVRLGY HRDFVIDEDS QWLLLGWKGR TIYALSCWKP V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-493767608380Protein SCARECROW
5b3h_A2e-493707601379Protein SCARECROW
5b3h_D2e-493707601379Protein SCARECROW
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in cotyledons, leaves and flowers, and in the elongation zone in root. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc09g010920.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU1805730.0Solanum lycopersicum clone BAC C09HBa0142I14, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010325850.10.0scarecrow-like protein 9
RefseqXP_019071333.10.0scarecrow-like protein 9
SwissprotO809330.0SCL9_ARATH; Scarecrow-like protein 9
TrEMBLA0A3Q7IU670.0A0A3Q7IU67_SOLLC; Uncharacterized protein
STRINGSolyc09g010920.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]