PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc09g008390.1.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 132aa MW: 15545 Da PI: 10.4296 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 49.3 | 1.1e-15 | 17 | 64 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W eEde+l+ +++ lG ++W++ a+ g++R++k+c++rw +yl Solyc09g008390.1.1 17 KGPWLDEEDERLAYVIAILGERRWDALAKASGLRRSGKSCRLRWMNYL 64 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 54.3 | 3e-17 | 73 | 115 | 4 | 48 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 T++E+ l++++ kqlG++ W++Ia+ ++ gRt++++k++w+++l Solyc09g008390.1.1 73 ITQDEEHLIIKLQKQLGNK-WSKIAKQLP-GRTDNEIKNYWRSHL 115 59*****************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.055 | 12 | 64 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.24E-27 | 15 | 111 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.2E-12 | 16 | 66 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.1E-13 | 17 | 64 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.6E-20 | 18 | 71 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.94E-8 | 19 | 64 | No hit | No description |
PROSITE profile | PS51294 | 26.199 | 65 | 119 | IPR017930 | Myb domain |
SMART | SM00717 | 3.6E-14 | 69 | 117 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.1E-25 | 72 | 118 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 3.3E-15 | 73 | 115 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 6.00E-10 | 74 | 115 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
MDFTLQLVTM EEEKLRKGPW LDEEDERLAY VIAILGERRW DALAKASGLR RSGKSCRLRW 60 MNYLRPNLKH GHITQDEEHL IIKLQKQLGN KWSKIAKQLP GRTDNEIKNY WRSHLRKKTL 120 ICEQGSIRHS P* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 1e-27 | 15 | 119 | 2 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1h88_C | 6e-27 | 15 | 119 | 56 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 6e-27 | 15 | 119 | 56 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 1e-27 | 15 | 119 | 2 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 1e-27 | 15 | 119 | 2 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00406 | DAP | Transfer from AT3G53200 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc09g008390.1.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates in etiolated seedlings in dark conditions. {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015167290.1 | 4e-85 | PREDICTED: myb-related protein MYBAS1-like | ||||
Swissprot | Q9SCP1 | 9e-52 | MYB27_ARATH; Transcription factor MYB27 | ||||
TrEMBL | A0A3Q7HYP8 | 7e-84 | A0A3Q7HYP8_SOLLC; Uncharacterized protein | ||||
STRING | Solyc09g008390.1.1 | 3e-92 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53200.1 | 4e-54 | myb domain protein 27 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc09g008390.1.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|