PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc08g068760.1.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | GRF | ||||||||
Protein Properties | Length: 156aa MW: 17395.8 Da PI: 8.7185 | ||||||||
Description | GRF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRC | 59.1 | 7.2e-19 | 106 | 139 | 2 | 35 |
WRC 2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrg 35 epgrC+RtDGK WRCsr+v + kk CE+H+hrg Solyc08g068760.1.1 106 LEPGRCKRTDGKNWRCSRDVAPHKKSCEHHMHRG 139 69*******************************8 PP | |||||||
2 | QLQ | 48 | 3.9e-17 | 47 | 81 | 2 | 36 |
QLQ 2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 +FT+aQ+ +L +Q+++yKy+++ + vPp+Ll+ i+ Solyc08g068760.1.1 47 PFTWAQWKELDRQAMIYKYMVSAMSVPPDLLLSIF 81 9********************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00951 | 2.2E-9 | 46 | 82 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
Pfam | PF08880 | 1.1E-11 | 47 | 81 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
PROSITE profile | PS51666 | 19.035 | 47 | 82 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
PROSITE profile | PS51667 | 19.026 | 105 | 151 | IPR014977 | WRC domain |
Pfam | PF08879 | 3.1E-15 | 107 | 139 | IPR014977 | WRC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005524 | Molecular Function | ATP binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 156 aa Download sequence Send to blast |
MENSKNCYTI CSTDEANLLP LPPSTAVVRS FDVATNSQGM ATALGYPFTW AQWKELDRQA 60 MIYKYMVSAM SVPPDLLLSI FSGASHTTSA TGSVQGQRYT TNIRDLEPGR CKRTDGKNWR 120 CSRDVAPHKK SCEHHMHRGL SILKDGNLIQ VYIYF* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during the early stages of leaf development and expression decreases with the maturation of the leaf. {ECO:0000269|PubMed:20023165}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Component of a network formed by miR396, the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc08g068760.1.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: microRNA 396 (miR396a or miR396b) negatively regulates growth-regulating factors (GRF1-4 and GRF7-9). {ECO:0000269|PubMed:15200956, ECO:0000269|PubMed:19453503, ECO:0000269|PubMed:20023165}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP010940 | 0.0 | Solanum lycopersicum DNA, chromosome 8, clone: C08HBa0195L01, complete sequence |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015068264.1 | 6e-79 | growth-regulating factor 3-like isoform X1 | ||||
Refseq | XP_027771148.1 | 6e-79 | growth-regulating factor 3-like isoform X2 | ||||
Swissprot | Q9FJB8 | 3e-26 | GRF7_ARATH; Growth-regulating factor 7 | ||||
TrEMBL | A0A3Q7ILA5 | 1e-115 | A0A3Q7ILA5_SOLLC; Uncharacterized protein | ||||
STRING | Solyc08g068760.1.1 | 1e-115 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA7032 | 22 | 30 | Representative plant | OGRP460 | 16 | 84 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G53660.1 | 2e-26 | growth-regulating factor 7 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc08g068760.1.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|