Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | NAM | 173.7 | 5.3e-54 | 10 | 143 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91
lppGfrFhPtdeel+++yL +k+++ +++ ++i++vd++k+ePwdLp k+k + kewyfFs rd+ky+tg r+nrat+sgyWk+tgkdke
Solyc08g006020.2.1 10 LPPGFRFHPTDEELITYYLVNKINDANFTG-RAIADVDLNKSEPWDLPGKAKMGGKEWYFFSLRDRKYPTGVRTNRATNSGYWKTTGKDKE 99
79*************************999.89***************999999************************************* PP
NAM 92 vlsk..kgel.......vglkktLvfykgrapkgektdWvmheyrl 128
++++ + + +g+kktLvfykgrap+gek++Wvmheyr+
Solyc08g006020.2.1 100 IFNSknN--NnnnnlelIGMKKTLVFYKGRAPRGEKSNWVMHEYRI 143
***8551..34556677***************************97 PP
|
3D Structure ? help Back to Top |
|
PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
1ut4_A | 2e-54 | 1 | 171 | 6 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-54 | 1 | 171 | 6 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-54 | 1 | 171 | 6 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-54 | 1 | 171 | 6 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-54 | 1 | 171 | 9 | 174 | NAC domain-containing protein 19 |
3swm_B | 2e-54 | 1 | 171 | 9 | 174 | NAC domain-containing protein 19 |
3swm_C | 2e-54 | 1 | 171 | 9 | 174 | NAC domain-containing protein 19 |
3swm_D | 2e-54 | 1 | 171 | 9 | 174 | NAC domain-containing protein 19 |
3swp_A | 2e-54 | 1 | 171 | 9 | 174 | NAC domain-containing protein 19 |
3swp_B | 2e-54 | 1 | 171 | 9 | 174 | NAC domain-containing protein 19 |
3swp_C | 2e-54 | 1 | 171 | 9 | 174 | NAC domain-containing protein 19 |
3swp_D | 2e-54 | 1 | 171 | 9 | 174 | NAC domain-containing protein 19 |
4dul_A | 2e-54 | 1 | 171 | 6 | 171 | NAC domain-containing protein 19 |
4dul_B | 2e-54 | 1 | 171 | 6 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression --
Description ? help
Back to Top |
Source |
Description |
Uniprot | DEVELOPMENTAL STAGE: First expressed in early to mid-globular-stage embryos. In late globular stage, detected as a stripe running medially across the top of the embryo. In heart stage embryo, expression is restricted to a stripe between the cotyledon primordia, but confined to hypodermal cells. In the bending-cotyledon stage, localized in a region surrounding the SAM, that correspond to the boundary region of cotyledon margins (BCM) and the boundaries between SAM and cotyledons, including protoderm cells. Observed in the margins of leaf primordia, and later restricted to the leaf sinus region, with a diminution in outgrowing teeth. Restricted to the proximal part of mature leaves. Expressed at the boundaries between the inflorescence meristem (IM) and flower primordia. Once the flower starts to grow out and the internode begin to elongates, restricted to the axils of the floral pedicels through several nodes. Detected within floral primordia, between sepal primordia and the floral meristem. Also present at the boundaries of individual sepal primordia, as well as in the region surrounding each petal and stamen primordium. Later detected transiently at the boundaries between locules of each theca in anthers. Expression at the inner part of presumtive septal regions that raises to include presumptive placenta, at the tips of septal primordia, as septum grow. Localized in the fused region of the septum. Found at the boundaries of ovule primordia, and later at the boundary between the nucellus and the chalaza. {ECO:0000269|PubMed:10079219, ECO:0000269|PubMed:10750709, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:17251269}. |
Uniprot | TISSUE SPECIFICITY: Mostly expressed in buds and flowers, and, to a lower extent, in the aerial parts of seedling, inflorescence and old silique. In a general manner, present at the boundaries between mersitems and araising primordia. {ECO:0000269|PubMed:10750709, ECO:0000269|PubMed:15053771, ECO:0000269|PubMed:9212461}. |
Publications
? help Back to Top |
- Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments. Theor. Appl. Genet., 2005. 112(1): p. 72-84 [PMID:16208505] - Wang YX
Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress. Mol. Biol. Rep., 2013. 40(11): p. 6451-8 [PMID:24057250] - Kamiuchi Y,Yamamoto K,Furutani M,Tasaka M,Aida M
The CUC1 and CUC2 genes promote carpel margin meristem formation during Arabidopsis gynoecium development. Front Plant Sci, 2014. 5: p. 165 [PMID:24817871] - Gonçalves B, et al.
A conserved role for CUP-SHAPED COTYLEDON genes during ovule development. Plant J., 2015. 83(4): p. 732-42 [PMID:26119568] - Du Q,Wang H
The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation. Plant Signal Behav, 2015. 10(10): p. e1078955 [PMID:26340415] - Vialette-Guiraud AC, et al.
A Conserved Role for the NAM/miR164 Developmental Module Reveals a Common Mechanism Underlying Carpel Margin Fusion in Monocarpous and Syncarpous Eurosids. Front Plant Sci, 2015. 6: p. 1239 [PMID:26793217] - Cui X, et al.
REF6 recognizes a specific DNA sequence to demethylate H3K27me3 and regulate organ boundary formation in Arabidopsis. Nat. Genet., 2016. 48(6): p. 694-9 [PMID:27111035] - Blein T,Pautot V,Laufs P
Combinations of Mutations Sufficient to Alter Arabidopsis Leaf Dissection. Plants (Basel), 2013. 2(2): p. 230-47 [PMID:27137374] - Biot E, et al.
Multiscale quantification of morphodynamics: MorphoLeaf software for 2D shape analysis. Development, 2016. 143(18): p. 3417-28 [PMID:27387872] - Zheng M, et al.
Chloroplast Translation Initiation Factors Regulate Leaf Variegation and Development. Plant Physiol., 2016. 172(2): p. 1117-1130 [PMID:27535792] - Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D
SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis. Plant J., 2017. 90(3): p. 435-446 [PMID:28161901] - Koyama T,Sato F,Ohme-Takagi M
Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549] - González-Carranza ZH, et al.
HAWAIIAN SKIRT controls size and floral organ number by modulating CUC1 and CUC2 expression. PLoS ONE, 2017. 12(9): p. e0185106 [PMID:28934292] - Wilson-Sánchez D,Martínez-López S,Navarro-Cartagena S,Jover-Gil S,Micol JL
Members of the DEAL subfamily of the DUF1218 gene family are required for bilateral symmetry but not for dorsoventrality in Arabidopsis leaves. New Phytol., 2018. 217(3): p. 1307-1321 [PMID:29139551] - Gonçalves B, et al.
GDP-L-fucose is required for boundary definition in plants. J. Exp. Bot., 2017. 68(21-22): p. 5801-5811 [PMID:29186469] - Sha S, et al.
To be serrate or pinnate: diverse leaf forms of yarrows (Achillea) are linked to differential expression patterns of NAM genes. Ann. Bot., 2018. 121(2): p. 255-266 [PMID:29267935] - Maugarny-Calès A, et al.
Dissecting the pathways coordinating patterning and growth by plant boundary domains. PLoS Genet., 2019. 15(1): p. e1007913 [PMID:30677017]
|