PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc07g065270.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 539aa    MW: 60016.9 Da    PI: 5.1489
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc07g065270.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS444.57.2e-1361685381374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l+e+L++cA+a+++++l  a++l+++l++ +s  g+p+qRl ay++e+L arla+s+s++ykal+++e +   s+e +++++l++e++P++
  Solyc07g065270.1.1 168 LKEVLIACAKAIAENNLITAEWLMSELRTVVSVCGSPIQRLGAYMLEGLVARLASSGSSIYKALRCKEPT---SVELFSYMHLLYEICPYF 255
                         5789*****************************************************************9...9***************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         kf++l aN aI++a++ e+ +HiiDf+i qG QW++L++aLa+Rp+gpp++RiTg+++++s   +   +e +g+rL+++A++++vpfef++
  Solyc07g065270.1.1 256 KFGYLSANGAIVDAMKDENSIHIIDFQIAQGSQWITLIHALAARPGGPPRIRITGIDDSTSAyaRGGGIEIVGRRLSSIAASCNVPFEFHP 346
                         **********************************************************998899999************************ PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          v+ ++ d+e+e+L+v pgE laVn++l lh+++desv ++++rd++L++vkslsPk+v++veqe+++n+++F+ rfle+l+yy ++f+s+
  Solyc07g065270.1.1 347 -VSASCPDIEIEHLKVLPGEPLAVNFALVLHHMPDESVGTQNHRDRLLRMVKSLSPKIVTLVEQESNTNTAQFFPRFLETLNYYLSVFESI 436
                         .799*************************************************************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         ++ lpr+++eri+vE+++l+reivn++acegaer+erhe le+Wr+r+  aGFkp+pls+++++++k+ll+++++  y+++e++g+l+lgW
  Solyc07g065270.1.1 437 DVALPRDHKERINVEQHCLAREIVNILACEGAERVERHELLERWRSRFAVAGFKPYPLSSSVNATIKTLLENYYQS-YTLNERNGALYLGW 526
                         **************************************************************************55.************** PP

                GRAS 363 kdrpLvsvSaWr 374
                         ++r Lv+ +aW+
  Solyc07g065270.1.1 527 MNRDLVASCAWK 538
                         ***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.926142519IPR005202Transcription factor GRAS
PfamPF035142.5E-133168538IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 539 aa     Download sequence    Send to blast
MRPSQNPEEI NEFNKFYNQP IEYQESYFLP SVNNPNNNQS FYADVSALKP AQHCYVESSA  60
GNSSELVSDS PPIVNFNPMM NQGSDSCRSD MHHSPDDTFQ SSGNSSCYTS DVTDLKHKLR  120
ELETAMLGPD SESLESFNNT IPVTAANQVP SESDKLVGMM EMMPSGDLKE VLIACAKAIA  180
ENNLITAEWL MSELRTVVSV CGSPIQRLGA YMLEGLVARL ASSGSSIYKA LRCKEPTSVE  240
LFSYMHLLYE ICPYFKFGYL SANGAIVDAM KDENSIHIID FQIAQGSQWI TLIHALAARP  300
GGPPRIRITG IDDSTSAYAR GGGIEIVGRR LSSIAASCNV PFEFHPVSAS CPDIEIEHLK  360
VLPGEPLAVN FALVLHHMPD ESVGTQNHRD RLLRMVKSLS PKIVTLVEQE SNTNTAQFFP  420
RFLETLNYYL SVFESIDVAL PRDHKERINV EQHCLAREIV NILACEGAER VERHELLERW  480
RSRFAVAGFK PYPLSSSVNA TIKTLLENYY QSYTLNERNG ALYLGWMNRD LVASCAWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-6717553726378Protein SCARECROW
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.70010.0cell culture| flower| fruit| leaf| root
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc07g065270.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ3998290.0Lycopersicon esculentum GRAS7 (GRAS7) mRNA, partial cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004244053.10.0scarecrow-like protein 21
RefseqXP_004244054.10.0scarecrow-like protein 21
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A3Q7HFS10.0A0A3Q7HFS1_SOLLC; Uncharacterized protein
STRINGSolyc07g065270.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Representative plantOGRP14091447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Mayrose M,Ekengren SK,Melech-Bonfil S,Martin GB,Sessa G
    A novel link between tomato GRAS genes, plant disease resistance and mechanical stress response.
    Mol. Plant Pathol., 2006. 7(6): p. 593-604
    [PMID:20507472]
  4. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  5. Heyman J, et al.
    The heterodimeric transcription factor complex ERF115-PAT1 grants regeneration competence.
    Nat Plants, 2016. 2(11): p. 16165
    [PMID:27797356]