PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc07g062980.2.1 | ||||||||
Common Name | LOC101258473 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 133aa MW: 15039.3 Da PI: 9.1368 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 131.4 | 3.2e-41 | 19 | 93 | 2 | 76 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 Cqve Cea+l ak+yh+rhkvC+vh+kap vl++gl+qrfCqqCs+fhelsefD +k+sCr rL++hn+rrrk+ Solyc07g062980.2.1 19 CQVETCEANLDGAKKYHKRHKVCQVHAKAPIVLLAGLKQRFCQQCSKFHELSEFDGTKKSCRLRLDGHNKRRRKT 93 *************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 1.6E-31 | 16 | 80 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 29.983 | 16 | 93 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 3.79E-37 | 17 | 95 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.1E-32 | 19 | 92 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 133 aa Download sequence Send to blast |
MANNDAGEGV VMQVMKHYCQ VETCEANLDG AKKYHKRHKV CQVHAKAPIV LLAGLKQRFC 60 QQCSKFHELS EFDGTKKSCR LRLDGHNKRR RKTPLPIELE DNQCRLINGE ARPHMDMTLS 120 SRNTIYTADI SG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 2e-31 | 19 | 92 | 11 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc07g062980.2.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004244240.1 | 2e-96 | squamosa promoter-binding-like protein 3 | ||||
Swissprot | Q38741 | 1e-34 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | A0A3Q7HEP3 | 4e-95 | A0A3Q7HEP3_SOLLC; Uncharacterized protein | ||||
STRING | Solyc07g062980.2.1 | 7e-96 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA749 | 24 | 105 | Representative plant | OGRP97 | 17 | 230 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33810.1 | 2e-36 | squamosa promoter binding protein-like 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc07g062980.2.1 |
Entrez Gene | 101258473 |
Publications ? help Back to Top | |||
---|---|---|---|
|