PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc07g054960.1.1 | ||||||||
Common Name | LOC101257982 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 217aa MW: 25672.6 Da PI: 7.7313 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50.4 | 5.2e-16 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W+++Ed +l ++++G ++W+ +++ g+ R++k+c++rw +yl Solyc07g054960.1.1 14 RGAWSEDEDNKLRAFIQKFGHPNWRQLPKYAGLMRCGKSCRLRWMNYL 61 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 55.3 | 1.5e-17 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+ + eE++l+++++++lG++ W+ Ia++++ gR+++++k++w+ + Solyc07g054960.1.1 67 KGNYSHEEEQLIIKLHNKLGNR-WSEIAAKLP-GRSDNDVKNHWHAH 111 7899******************.*********.***********976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.934 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.16E-29 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.3E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.5E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-21 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.66E-10 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 24.925 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 4.3E-17 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.0E-16 | 67 | 111 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.6E-25 | 69 | 115 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.54E-11 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 217 aa Download sequence Send to blast |
MVRTPFIDKN GIKRGAWSED EDNKLRAFIQ KFGHPNWRQL PKYAGLMRCG KSCRLRWMNY 60 LRPGLKKGNY SHEEEQLIIK LHNKLGNRWS EIAAKLPGRS DNDVKNHWHA HLKKRPRLTN 120 TYSSTSEQFT ESSQFDSQNH DQQSYEDGYN LSNTINGMDW IEENNNHIKT MEQLSSINNT 180 LVEQSLPNNF QIETFDFNFW SEPLFDDFWT QSFFFQ* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-26 | 14 | 115 | 7 | 107 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: In nonelongating internodes, highly expressed in interfascicular fibers and xylem cells but not in parenchymatous pith cells. In elongating internodes, predominantly expressed in protoxylem vessels. {ECO:0000269|PubMed:19122102}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in leaves (PubMed:9839469). Specifically expressed in fibers and vessels undergoing secondary wall thickening, especially in inflorescence stems (PubMed:19122102). {ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:9839469}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that binds DNA to the AC cis-elements 5'-ACCTACC-3', 5'-ACCAACC-3' and 5'-ACCTAAC-3' of promoters and specifically activates lignin biosynthetic genes during secondary wall formation mediated by SND1. {ECO:0000269|PubMed:19122102}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc07g054960.1.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by light (PubMed:9839469). Regulated by the SND1 close homologs NST1, NST2, VND6, and VND7 and their downstream targets MYB46 and MYB83 (PubMed:19122102, PubMed:22197883). {ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:22197883, ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC244804 | 2e-08 | Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-74b18 map 10, complete sequence | |||
GenBank | L41253 | 2e-08 | Lycopersicon esculentum Hsc70 (Hsc70) gene, complete cds |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015160634.1 | 1e-140 | PREDICTED: myb-related protein Myb4-like | ||||
Swissprot | Q9SA47 | 4e-54 | MYB58_ARATH; Transcription factor MYB58 | ||||
TrEMBL | A0A3Q7HD52 | 1e-161 | A0A3Q7HD52_SOLLC; Uncharacterized protein | ||||
STRING | Solyc07g054960.1.1 | 1e-162 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G79180.1 | 2e-55 | myb domain protein 63 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc07g054960.1.1 |
Entrez Gene | 101257982 |
Publications ? help Back to Top | |||
---|---|---|---|
|