PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc06g076290.1.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 126aa MW: 14089.4 Da PI: 10.0068 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 31.1 | 3.1e-10 | 8 | 61 | 67 | 120 |
GRAS 67 setseknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdis 120 ++++ + ++ l+a+++++ +sP+ +s+++aN+ I + +++ +HiiDf+i Solyc06g076290.1.1 8 FAKRRISAADILKAFQVYVTASPFRMMSNIIANKSIGMLTREATSIHIIDFGIL 61 44445558999*****************************************95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 9.29 | 1 | 125 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 1.0E-7 | 8 | 61 | IPR005202 | Transcription factor GRAS |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 126 aa Download sequence Send to blast |
MESLIRSFAK RRISAADILK AFQVYVTASP FRMMSNIIAN KSIGMLTREA TSIHIIDFGI 60 LITGIDFPQA GFRPAERVEE TGRRLVYENS PRDDVLRLIK QIKPDVFLHG IVNGAYNSNF 120 LCNSI* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, leaves, sepals, stamen and pistil, and in the quiescent center of root meristem. {ECO:0000269|PubMed:18500650}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc06g076290.1.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016576235.1 | 6e-44 | PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 14 | ||||
Swissprot | Q9SNB8 | 9e-24 | SCL30_ARATH; Scarecrow-like protein 30 | ||||
TrEMBL | A0A2G2WND4 | 2e-44 | A0A2G2WND4_CAPBA; Scarecrow-like protein 11 | ||||
TrEMBL | A0A2G3CBK2 | 6e-45 | A0A2G3CBK2_CAPCH; Scarecrow-like protein 30 | ||||
STRING | Solyc06g076290.1.1 | 4e-87 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA28432 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G46600.2 | 3e-26 | GRAS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc06g076290.1.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|