PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc05g053330.2.1
Common NameLOC101265734
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB
Protein Properties Length: 319aa    MW: 36923.1 Da    PI: 6.7925
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc05g053330.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.4e-183885148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+WT eEd  l++ ++ +G g+W++ ar+ g++Rt+k+c++rw++yl
  Solyc05g053330.2.1 38 RGPWTVEEDFTLINFIAHHGEGRWNSLARCAGLKRTGKSCRLRWLNYL 85
                        89********************************************97 PP

2Myb_DNA-binding51.42.4e-1691134146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Solyc05g053330.2.1  91 RGNITVEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 134
                         7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.4593385IPR017930Myb domain
SuperFamilySSF466897.49E-3135132IPR009057Homeodomain-like
SMARTSM007175.1E-153787IPR001005SANT/Myb domain
PfamPF002495.0E-163885IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-213992IPR009057Homeodomain-like
CDDcd001671.44E-114085No hitNo description
PROSITE profilePS5129423.66686140IPR017930Myb domain
SMARTSM007175.6E-1590138IPR001005SANT/Myb domain
PfamPF002494.4E-1591134IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-2393139IPR009057Homeodomain-like
CDDcd001672.56E-1195134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009620Biological Processresponse to fungus
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MDYHGQKIEV ISGRGREGGR GDSKEEIKEE EIVMDLRRGP WTVEEDFTLI NFIAHHGEGR  60
WNSLARCAGL KRTGKSCRLR WLNYLRPDVR RGNITVEEQL LILELHSRWG NRWSKIAQHL  120
PGRTDNEIKN YWRTRVQKHA KQLKCDVNSK QFKDTMKYLW MPRLAERIQA AAATSNPTAA  180
SSSGPTTTYI QSQEIQHLLP NMNHHVPEYL PIQLMNIEKT NSLNYSATST SSDNYSSDLT  240
DGCYNFSINQ SNNQDHSHVN QSTNQLLYEE STINPTSYNF HPGFQGFQEV DQQNNTQWME  300
NPWNIEDMCF LQQLNNDM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-24331382106B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00334DAPTransfer from AT3G06490Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc05g053330.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004239882.10.0transcription factor MYB78-like
TrEMBLA0A3Q7GN670.0A0A3Q7GN67_SOLLC; Uncharacterized protein
STRINGSolyc05g053330.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13972375
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.12e-85myb domain protein 78
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]