PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc05g053150.1.1 | ||||||||
Common Name | LOC101248880 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 230aa MW: 27331.1 Da PI: 9.4921 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.9 | 2.3e-18 | 13 | 60 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT eEd+ll+d+v+++G g+W+ +ar g++R +k+c++rw +yl Solyc05g053150.1.1 13 KGPWTVEEDKLLIDYVNLHGEGRWNCVARLAGLKRNGKSCRLRWVNYL 60 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 48.8 | 1.6e-15 | 66 | 110 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg T+ E+ +++++++ +G++ W+tIar ++ gRt++++k++w+++ Solyc05g053150.1.1 66 RGQITPYEERIILELHAIWGNR-WSTIARNLP-GRTDNEIKNYWRTH 110 6788999***************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.308 | 8 | 60 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.47E-30 | 11 | 107 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.6E-15 | 12 | 62 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.3E-16 | 13 | 60 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.4E-23 | 14 | 67 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.09E-10 | 15 | 60 | No hit | No description |
PROSITE profile | PS51294 | 24.931 | 61 | 115 | IPR017930 | Myb domain |
SMART | SM00717 | 5.3E-14 | 65 | 113 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.1E-13 | 66 | 110 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.7E-24 | 68 | 116 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.16E-9 | 70 | 111 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 230 aa Download sequence Send to blast |
MRRWGIIEEE WRKGPWTVEE DKLLIDYVNL HGEGRWNCVA RLAGLKRNGK SCRLRWVNYL 60 RPDLKRGQIT PYEERIILEL HAIWGNRWST IARNLPGRTD NEIKNYWRTH FKKKVKKTST 120 DNSEKTKRIC LLKRHQFQQQ QLSNSQIDLK RMMLLFEENE NKVVSHVPKQ DMTILYHNNT 180 FHEQDQQGGL FGSMINGYAN YVQVPEASSN EDIMWDIGLW NLDDYNVNL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-27 | 13 | 115 | 7 | 108 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Highly expressed in leaves. Expressed in roots and shoots. Expressed at low levels in flowers. {ECO:0000269|PubMed:22301384}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269|PubMed:22301384}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc05g053150.1.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269|PubMed:22301384}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF426174 | 3e-07 | Lycopersicon esculentum blind mRNA, complete cds |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004240221.1 | 1e-171 | transcription factor MYB24-like | ||||
Swissprot | Q10MB4 | 1e-52 | MYB2_ORYSJ; Transcription factor MYB2 | ||||
TrEMBL | A0A3Q7GLT8 | 1e-170 | A0A3Q7GLT8_SOLLC; Uncharacterized protein | ||||
STRING | Solyc05g053150.1.1 | 1e-170 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G24310.1 | 3e-77 | myb domain protein 305 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc05g053150.1.1 |
Entrez Gene | 101248880 |