PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc05g021090.2.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 280aa MW: 32565.5 Da PI: 7.5875 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 156.4 | 1.3e-48 | 17 | 141 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 pGfrFhPtdeel+ +yL++kve+k++++ e i+++diyk++PwdLp ka++ke+y+F+ r +ky+++ r+nr+tk g+Wkatg dk+v Solyc05g021090.2.1 17 LPGFRFHPTDEELIGFYLRRKVENKRISM-ELIRHIDIYKYDPWDLP---KADDKEMYYFCMRGRKYKNSVRPNRVTKGGFWKATGIDKPV 103 69***************************.99***************...56899************************************ PP NAM 93 lskkgel..vglkktLvfykgrapkgektdWvmheyrl 128 +s++++ +glkk Lv+y+g+a kg+ktdW+mhe+rl Solyc05g021090.2.1 104 YSSTTKCiiIGLKKCLVYYRGSAGKGTKTDWMMHEFRL 141 **84433459**************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.24E-53 | 15 | 162 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 52.095 | 16 | 162 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.7E-24 | 18 | 141 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 280 aa Download sequence Send to blast |
MVDEIKTMSK EEEDVILPGF RFHPTDEELI GFYLRRKVEN KRISMELIRH IDIYKYDPWD 60 LPKADDKEMY YFCMRGRKYK NSVRPNRVTK GGFWKATGID KPVYSSTTKC IIIGLKKCLV 120 YYRGSAGKGT KTDWMMHEFR LPPTSNTNQQ AEVWTLCRIF KRSSSTYTRS SYNTQEVKHP 180 IGDASSKACS LESDENSTDH DHSNSFRDMS FPHQNYNNYV AQMDETRNQQ NPIPHESTFP 240 SSSSISFWNT NSTQEDYLFG DHGNKWDDLK SIVDLATMM* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-46 | 18 | 166 | 19 | 169 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-46 | 18 | 166 | 19 | 169 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-46 | 18 | 166 | 19 | 169 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-46 | 18 | 166 | 19 | 169 | NO APICAL MERISTEM PROTEIN |
3swm_A | 4e-46 | 18 | 166 | 22 | 172 | NAC domain-containing protein 19 |
3swm_B | 4e-46 | 18 | 166 | 22 | 172 | NAC domain-containing protein 19 |
3swm_C | 4e-46 | 18 | 166 | 22 | 172 | NAC domain-containing protein 19 |
3swm_D | 4e-46 | 18 | 166 | 22 | 172 | NAC domain-containing protein 19 |
3swp_A | 4e-46 | 18 | 166 | 22 | 172 | NAC domain-containing protein 19 |
3swp_B | 4e-46 | 18 | 166 | 22 | 172 | NAC domain-containing protein 19 |
3swp_C | 4e-46 | 18 | 166 | 22 | 172 | NAC domain-containing protein 19 |
3swp_D | 4e-46 | 18 | 166 | 22 | 172 | NAC domain-containing protein 19 |
4dul_A | 3e-46 | 18 | 166 | 19 | 169 | NAC domain-containing protein 19 |
4dul_B | 3e-46 | 18 | 166 | 19 | 169 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, root caps, cotyledons, tips and margin of young leaves, senescent regions of fully expanded leaves and floral tissues, including old sepals, petals, staments, mature anthers and pollen grains. Not detected in the abscission zone of open flowers, emerging lateral roots and root meristematic zones. {ECO:0000269|PubMed:22345491}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269|PubMed:22345491}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc05g021090.2.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269|PubMed:22345491}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC215362 | 4e-13 | Solanum lycopersicum chromosome 2 clone C02HBa0027B01, complete sequence |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019069297.1 | 0.0 | transcription factor JUNGBRUNNEN 1-like isoform X1 | ||||
Swissprot | Q9SK55 | 1e-86 | NAC42_ARATH; Transcription factor JUNGBRUNNEN 1 | ||||
TrEMBL | A0A3Q7GJY2 | 0.0 | A0A3Q7GJY2_SOLLC; Uncharacterized protein | ||||
STRING | Solyc05g021090.2.1 | 0.0 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1697 | 24 | 69 | Representative plant | OGRP17 | 15 | 800 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G43000.1 | 3e-82 | NAC domain containing protein 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc05g021090.2.1 |