PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Solyc04g009440.2.1

Common Name

SlNAC1

Organism

Solanum lycopersicum

Taxonomic ID

4081

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

NAC

Protein Properties

Length: 302aa MW: 34835.2 Da PI: 7.8928

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Solyc04g009440.2.1	genome	ITAG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	165.7	1.6e-51	13	137	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 lp+GfrFhPtd+elv++yL++k++g+++ + ++i+e+d+yk++Pw+Lp+k+ +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk+ Solyc04g009440.2.1 13 LPAGFRFHPTDDELVQHYLCRKCAGQSIAV-SIIAEIDLYKFDPWQLPEKALYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKP 102 799***********************99.89***********8777889********************************** PP NAM 92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 v + ++ g+kk Lvfy g+ap+g kt+W+mheyrl Solyc04g009440.2.1 103 VGK--PKTLGIKKALVFYAGKAPRGIKTNWIMHEYRL 137 98..778**************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	3.27E-61	9	163	IPR003441	NAC domain
PROSITE profile	PS51005	59.279	13	163	IPR003441	NAC domain
Pfam	PF02365	3.8E-27	14	137	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 302 aa Download sequence Send to blast
MNKGANGNQQ LELPAGFRFH PTDDELVQHY LCRKCAGQSI AVSIIAEIDL YKFDPWQLPE 60 KALYGEKEWY FFSPRDRKYP NGSRPNRAAG TGYWKATGAD KPVGKPKTLG IKKALVFYAG 120 KAPRGIKTNW IMHEYRLANV DRSAGKNNNL RLDDWVLCRI YNKKGTLEKH YNVDNKETTS 180 FGEFDEEIKP KILPTQLAPM PPRPRSTPAN DYFYFESSES MTRMHTTNSS SGSEHVLSPC 240 DKEVQSAPKW DEDHRNTLDF QLNYLDGLLN EPFETQMQQQ ICNFDQFNNF QDMFLYMQKP 300 Y*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	8e-86	1	169	3	174	Stress-induced transcription factor NAC1
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Les.4483	0.0	cell culture\| flower\| fruit\| leaf\| root\| stem

Function -- GeneRIF ? help Back to Top
Upregulation of the NAC1 gene is associated with pathogen infection defense. [PMID: 23278405] SlNAC1 was highly accumulated in immature green fruits; expression increased with fruit ripening until 7 days after the breaker stage. Overexpression resulted in reduced carotenoids by altering carotenoid pathway flux and decreasing ethylene synthesis. [PMID: 25491370] The tomato defense-related transcription factor NAC1 interacts with the ubiquitin ligase SINA3.SINA3 possesses ubiquitin ligase activity and ubiquitinates NAC1. [PMID: 26879496] SlNAC1 is involved in controlling tomato fruit ripening. SlNAC1 inhibited the expressions of SlACS2, SlACS4, SlACO1, and SlPSY1; as a result, ethylene and lycopene levels were reduced. [SlNAC1] [PMID: 26962710]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Solyc04g009440.2.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY498713	0.0	Lycopersicon esculentum NAC domain protein mRNA, complete cds
GenBank	EU670750	0.0	Solanum lycopersicum cultivar LA2711 NAC domain protein 1 (SlNAC1) mRNA, complete cds

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001234482.1	0.0	NAC domain protein
Swissprot	Q39013	1e-123	NAC2_ARATH; NAC domain-containing protein 2
TrEMBL	M9TNM6	0.0	M9TNM6_SOLPI; NAC domain protein
TrEMBL	Q6RH27	0.0	Q6RH27_SOLLC; NAC domain protein
STRING	Solyc04g009440.2.1	0.0	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1239	24	81
Representative plant	OGRP17	15	800

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G01720.1	1e-123	NAC family protein

Link Out ? help Back to Top
Phytozome	Solyc04g009440.2.1
Entrez Gene	543917

Publications ? help Back to Top
Selth LA, et al. A NAC domain protein interacts with tomato leaf curl virus replication accessory protein and enhances viral replication. Plant Cell, 2005. 17(1): p. 311-25 [PMID:15608335] Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments. Theor. Appl. Genet., 2005. 112(1): p. 72-84 [PMID:16208505] Ouyang B, et al. Identification of early salt stress response genes in tomato root by suppression subtractive hybridization and microarray analysis. J. Exp. Bot., 2007. 58(3): p. 507-20 [PMID:17210988] Huang W, et al. SlNAC1, a stress-related transcription factor, is fine-tuned on both the transcriptional and the post-translational level. New Phytol., 2013. 197(4): p. 1214-24 [PMID:23278405] Florentin A,Damri M,Grafi G Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization. Dev. Dyn., 2013. 242(10): p. 1121-33 [PMID:23798027] Jensen MK, et al. ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana. FEBS Open Bio, 2013. 3: p. 321-7 [PMID:23951554] Wang YX Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress. Mol. Biol. Rep., 2013. 40(11): p. 6451-8 [PMID:24057250] Ma N, et al. Overexpression of tomato SlNAC1 transcription factor alters fruit pigmentation and softening. BMC Plant Biol., 2014. 14: p. 351 [PMID:25491370] Yang X, et al. Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis. Plant Cell Rep., 2015. 34(6): p. 943-58 [PMID:25666276] Du Q,Wang H The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation. Plant Signal Behav, 2015. 10(10): p. e1078955 [PMID:26340415] Lapidot M, et al. A Novel Route Controlling Begomovirus Resistance by the Messenger RNA Surveillance Factor Pelota. PLoS Genet., 2015. 11(10): p. e1005538 [PMID:26448569] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Miao M, et al. The ubiquitin ligase SEVEN IN ABSENTIA (SINA) ubiquitinates a defense-related NAC transcription factor and is involved in defense signaling. New Phytol., 2016. 211(1): p. 138-48 [PMID:26879496] Meng C, et al. Suppression of tomato SlNAC1 transcription factor delays fruit ripening. J. Plant Physiol., 2016. 193: p. 88-96 [PMID:26962710] Liu Y,Sun J,Wu Y Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice. J. Plant Res., 2016. 129(5): p. 955-962 [PMID:27216423] Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining. PLoS ONE, 2016. 11(9): p. e0162327 [PMID:27618630] Zhao J,Missihoun TD,Bartels D The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana. Planta, 2018. 248(4): p. 1017-1027 [PMID:30027414]