PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g112890.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB
Protein Properties Length: 346aa    MW: 40341.1 Da    PI: 6.1952
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g112890.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-16158204148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g WT eEd +l+++v+++G + W+ Ia+ +  gR +kqc++rw+++l
  Solyc03g112890.1.1 158 KGQWTIEEDRILINLVERFGDRKWSQIAQVLK-GRIGKQCRERWHNHL 204
                         799****************************9.*************97 PP

2Myb_DNA-binding51.81.8e-16212252345
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                          WT+eEd +l++a+ + G++ W+ Ia+++  gRt++++k++w+
  Solyc03g112890.1.1 212 LWTEEEDMILIKAHSEIGNK-WAEIAKKLA-GRTENSIKNHWN 252
                         6*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.783153208IPR017930Myb domain
SMARTSM007176.3E-14157206IPR001005SANT/Myb domain
SuperFamilySSF466892.35E-30157251IPR009057Homeodomain-like
PfamPF002491.3E-15158204IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-27159211IPR009057Homeodomain-like
CDDcd001677.68E-13161204No hitNo description
SMARTSM007175.8E-16209257IPR001005SANT/Myb domain
PROSITE profilePS5129420.11209259IPR017930Myb domain
PfamPF002498.3E-15212252IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.3E-22212258IPR009057Homeodomain-like
CDDcd001677.71E-12213255No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MEFDNQDVFC TPPKDYLQEF RHLDQNFMID MNNGYDPLFD PLSNHDDNFS SIGQDFNFGY  60
EFKPFDQNGS ASGSTLIMKN FESSMDSMNY NFMCNQDMKP INFNVVPDES SSCVSNNIDI  120
NGSKDKEIDG KNKKQILFSS SSMRKIGRVT RNKSKSVKGQ WTIEEDRILI NLVERFGDRK  180
WSQIAQVLKG RIGKQCRERW HNHLRPDIKK DLWTEEEDMI LIKAHSEIGN KWAEIAKKLA  240
GRTENSIKNH WNATKRRQFS RRKCRTKWPR PSSILQNYIK SLNFEKSNNN NNNAGKSTVE  300
EVPTFSDEFG LDKKLFDDLE IPYELMQDGE VNHKDLDLMD FDYSE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-431572583104C-Myb DNA-Binding Domain
1msf_C3e-431572583104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc03g112890.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU1247370.0Solanum lycopersicum chromosome 3 clone C03HBa0054O21, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004236532.20.0transcription factor MYB98-like
TrEMBLK4BKE20.0K4BKE2_SOLLC; Uncharacterized protein
STRINGSolyc03g112890.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31502349
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.11e-68myb domain protein 98
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]