PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc03g093890.2.1 | ||||||||
Common Name | LOC101245233 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 254aa MW: 29035.2 Da PI: 9.2342 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 44.8 | 3e-14 | 20 | 67 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd++l ++ ++G +W+ ++ g+ Rt+k+c++rw +yl Solyc03g093890.2.1 20 KGAWSPEEDQKLRGYIMKYGIWNWRQMPKFAGLSRTGKSCRLRWMNYL 67 79******************99************************97 PP | |||||||
2 | Myb_DNA-binding | 46.2 | 1e-14 | 73 | 118 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++TteE e+ ++ ++lG+ W++Ia++++ gRt++++k++++++l Solyc03g093890.2.1 73 RGPFTTEEVEIVIKTYQELGNS-WSAIAAKLP-GRTDNEVKNFFHTHL 118 89******************99.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 14.521 | 15 | 67 | IPR017930 | Myb domain |
SMART | SM00717 | 1.7E-11 | 19 | 69 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.39E-28 | 19 | 114 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 7.7E-13 | 20 | 67 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.2E-22 | 21 | 74 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.44E-9 | 22 | 67 | No hit | No description |
PROSITE profile | PS51294 | 21.685 | 68 | 122 | IPR017930 | Myb domain |
SMART | SM00717 | 3.2E-13 | 72 | 120 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.9E-13 | 73 | 118 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.7E-24 | 75 | 122 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.18E-9 | 75 | 118 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 254 aa Download sequence Send to blast |
MPRVQQQQQK GTSMEAIIKK GAWSPEEDQK LRGYIMKYGI WNWRQMPKFA GLSRTGKSCR 60 LRWMNYLRPD VKRGPFTTEE VEIVIKTYQE LGNSWSAIAA KLPGRTDNEV KNFFHTHLKK 120 HLGLKNHDVP LKTRKIRKQT KEDEKKISTR GRLVLETSNN SNLLTTDVCS PCSSITTCEE 180 NQMMDPFVNF SQTFEVCYNN ITSLVVDQQV PGMEHTCINI GVAQPHSIPH GPAVNSFDQF 240 DMNSFWIDVL GNI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 3e-23 | 4 | 120 | 11 | 126 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Les.23151 | 0.0 | cell culture |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, leaves, stems and flowers (PubMed:17015446, PubMed:19161942). Expressed in stomatal guard cells (PubMed:19161942). {ECO:0000269|PubMed:17015446, ECO:0000269|PubMed:19161942}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269|PubMed:17015446, ECO:0000269|PubMed:19161942}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc03g093890.2.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269|PubMed:19161942}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC246582 | 2e-08 | Solanum lycopersicum strain Heinz 1706 chromosome 1 clone slm-26i13 map 1, complete sequence | |||
GenBank | AC246642 | 2e-08 | Solanum lycopersicum strain Heinz 1706 chromosome 1 clone slm-41f18 map 1, complete sequence | |||
GenBank | GQ911580 | 2e-08 | Solanum lycopersicum hexose transporter 1 (HT1) mRNA, complete cds |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001333764.1 | 0.0 | R2R3MYB transcription factor 52 | ||||
Swissprot | Q9LTC4 | 2e-46 | MYB15_ARATH; Transcription factor MYB15 | ||||
TrEMBL | A0A3Q7FLR4 | 0.0 | A0A3Q7FLR4_SOLLC; Uncharacterized protein | ||||
STRING | Solyc03g093890.2.1 | 0.0 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G23250.1 | 8e-49 | myb domain protein 15 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc03g093890.2.1 |
Entrez Gene | 101245233 |