PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc03g078120.2.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 151aa MW: 17846.8 Da PI: 9.6677 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 146.2 | 1.7e-45 | 4 | 131 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 lppGfrFhPtd el+++yLk+k+ kk+ + evi+e++iyk+ P+dLp k ++k+++ ewyfF+++++kya+g + nr+t+ g+Wk tg+d Solyc03g078120.2.1 4 LPPGFRFHPTDVELIMYYLKRKIMVKKILF-EVISELNIYKFSPSDLPdKcCYKSKDLEWYFFCPSERKYASGFKMNRTTDIGFWKITGRD 93 79*************************988.99***************6545666777********************************* PP NAM 90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++vl +++ vg ktLvf++g+ap+ ++tdWv+heyr+ Solyc03g078120.2.1 94 RRVLY-DEKFVGSVKTLVFHQGKAPRVQRTDWVIHEYRF 131 *****.999****************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.02E-49 | 2 | 140 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 46.117 | 4 | 150 | IPR003441 | NAC domain |
Pfam | PF02365 | 9.6E-24 | 5 | 130 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 151 aa Download sequence Send to blast |
MAKLPPGFRF HPTDVELIMY YLKRKIMVKK ILFEVISELN IYKFSPSDLP DKCCYKSKDL 60 EWYFFCPSER KYASGFKMNR TTDIGFWKIT GRDRRVLYDE KFVGSVKTLV FHQGKAPRVQ 120 RTDWVIHEYR FEDKDTADAG FSLPTLNLIH * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 1e-40 | 4 | 131 | 15 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Les.7248 | 0.0 | flower| fruit| leaf |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the epidermal cells of the root apical region. {ECO:0000269|PubMed:20388856}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that binds specific DNA sequences on the promoter regions of target genes. {ECO:0000250|UniProtKB:Q9C8W9}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc03g078120.2.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC238471 | 1e-160 | Solanum lycopersicum chromosome 3 clone C03HBa0299H10, complete sequence | |||
GenBank | AC246830 | 1e-160 | Solanum lycopersicum strain Heinz 1706 chromosome 3 clone slm-5a16 map 3, complete sequence |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004235079.1 | 1e-101 | NAC domain-containing protein 82-like | ||||
Swissprot | Q9FY82 | 7e-58 | NAC82_ARATH; NAC domain-containing protein 82 | ||||
TrEMBL | A0A3Q7G8W9 | 1e-100 | A0A3Q7G8W9_SOLLC; Uncharacterized protein | ||||
STRING | Solyc03g078120.2.1 | 1e-109 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA6050 | 23 | 34 | Representative plant | OGRP17 | 15 | 800 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64060.1 | 2e-61 | NAC domain containing protein 103 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc03g078120.2.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|