PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc03g006830.2.1 | ||||||||
Common Name | FYFL | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 223aa MW: 25369.2 Da PI: 9.4562 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 91.5 | 4.2e-29 | 2 | 52 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++ rqvtfskRrng+ KKA+ELSvLCdaeva iifs++g+lye++s Solyc03g006830.2.1 2 KRIENSTSRQVTFSKRRNGLTKKAYELSVLCDAEVAFIIFSHKGRLYEFAS 52 79***********************************************86 PP | |||||||
2 | K-box | 74.5 | 3e-25 | 78 | 165 | 10 | 97 |
K-box 10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 e+ +e+l++e a++ k+ie L+ ++R+l+G++L+s+s+ eL+ + +qLe+ lk iR++K++l++e+ie l+ ke+ l ++n +Lr+k Solyc03g006830.2.1 78 LEHYMENLKHETANMAKKIEILEISKRKLMGQGLGSCSMDELEDIDSQLERTLKIIRARKTQLFKEEIESLKAKERLLLQQNASLREK 165 466789********************************************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
CDD | cd00265 | 1.80E-37 | 1 | 63 | No hit | No description |
SuperFamily | SSF55455 | 5.76E-30 | 1 | 81 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.1E-29 | 1 | 53 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 28.553 | 1 | 54 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.0E-26 | 3 | 50 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-17 | 16 | 31 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-17 | 31 | 52 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.3E-24 | 80 | 166 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.471 | 82 | 172 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009838 | Biological Process | abscission | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0080187 | Biological Process | floral organ senescence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 223 aa Download sequence Send to blast |
MKRIENSTSR QVTFSKRRNG LTKKAYELSV LCDAEVAFII FSHKGRLYEF ASSNMQKIIE 60 RYRGRARETT TVDKSTELEH YMENLKHETA NMAKKIEILE ISKRKLMGQG LGSCSMDELE 120 DIDSQLERTL KIIRARKTQL FKEEIESLKA KERLLLQQNA SLREKCGLRP MLSESASAPE 180 PIPAPPSTPP AQSKERGNCS QSTKSWEVET ELFIGLPQTR CL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3mu6_A | 8e-18 | 3 | 62 | 9 | 68 | Myocyte-specific enhancer factor 2A |
3mu6_B | 8e-18 | 3 | 62 | 9 | 68 | Myocyte-specific enhancer factor 2A |
3mu6_C | 8e-18 | 3 | 62 | 9 | 68 | Myocyte-specific enhancer factor 2A |
3mu6_D | 8e-18 | 3 | 62 | 9 | 68 | Myocyte-specific enhancer factor 2A |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Les.5147 | 0.0 | flower| leaf |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in the shoot apical meristem (SAM) during the vegetative phase and the floral transition. After floral transition, expressed in apical meristem (AM), inflorescence meristem (IM) and floral primordia. {ECO:0000269|PubMed:21609362}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in quiescent center (QC) cells of root tips (PubMed:18162590, PubMed:21689171). Expressed at the base of the petiole of cotyledons and leaves, in flower buds, petals, sepals and abscission zone of flowers and siliques. {ECO:0000269|PubMed:18162590, ECO:0000269|PubMed:21689171}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00576 | DAP | Transfer from AT5G62165 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc03g006830.2.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT013384 | 0.0 | Lycopersicon esculentum clone 135524R, mRNA sequence |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001276829.1 | 1e-163 | MADS-box protein SOC1-like | ||||
Swissprot | Q9FIS1 | 2e-71 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | W5S185 | 1e-162 | W5S185_SOLLC; MADS-box transcription factor FYFL | ||||
STRING | Solyc03g006830.2.1 | 1e-162 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA40 | 24 | 625 | Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.3 | 3e-72 | AGAMOUS-like 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc03g006830.2.1 |
Entrez Gene | 101266695 |
Publications ? help Back to Top | |||
---|---|---|---|
|