PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc02g086480.1.1 | ||||||||
Common Name | LOC101259013 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 150aa MW: 16649.6 Da PI: 6.7334 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 136.6 | 9.1e-43 | 12 | 110 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 +CaaCk+lrrkC ++C++ pyfp e+p+kf nvhk+FGasnv+kll++++ ++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l+ Solyc02g086480.1.1 12 PCAACKFLRRKCLPGCIFCPYFPPEDPQKFSNVHKIFGASNVSKLLNEIEAHQREDAVNSLAYEAEARMKDPVYGCVGAISVLQRQVIRLQ 102 7****************************************************************************************** PP DUF260 92 aelallke 99 +el+++++ Solyc02g086480.1.1 103 KELDATNA 110 ***99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 26.615 | 11 | 112 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 6.8E-42 | 12 | 109 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 150 aa Download sequence Send to blast |
MSCSSSSSSN PPCAACKFLR RKCLPGCIFC PYFPPEDPQK FSNVHKIFGA SNVSKLLNEI 60 EAHQREDAVN SLAYEAEARM KDPVYGCVGA ISVLQRQVIR LQKELDATNA DLMRYANANY 120 GTNNYGLYNN NNNTTWNNNP NPQPDDDIH* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 3e-65 | 5 | 121 | 4 | 120 | LOB family transfactor Ramosa2.1 |
5ly0_B | 3e-65 | 5 | 121 | 4 | 120 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Les.15359 | 0.0 | callus| cell culture| stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269|PubMed:12068116}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc02g086480.1.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006338596.1 | 1e-83 | PREDICTED: LOB domain-containing protein 25 | ||||
Swissprot | Q9FML4 | 1e-64 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | A0A3Q7FA69 | 1e-107 | A0A3Q7FA69_SOLLC; Uncharacterized protein | ||||
STRING | Solyc02g086480.1.1 | 1e-108 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA43 | 24 | 669 | Representative plant | OGRP60 | 16 | 318 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 2e-63 | LBD family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc02g086480.1.1 |
Entrez Gene | 101259013 |
Publications ? help Back to Top | |||
---|---|---|---|
|