PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc02g077920.2.1
Common NameLeSPL-CNR
Organism
Solanum lycopersicum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family SBP
Protein Properties Length: 137aa    MW: 15679.6 Da    PI: 8.8513
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc02g077920.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP137.15.1e-4352127277
                         -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                 SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                         Cqv++C+ad+++ak yhrrhkvCe+hsk+p vl+sgl++rfCqqCsrfh l efD++krsCrrrLa+hnerrrk +
  Solyc02g077920.2.1  52 CQVDQCTADMADAKPYHRRHKVCEFHSKSPIVLISGLQKRFCQQCSRFHLLAEFDDAKRSCRRRLAGHNERRRKIT 127
                         *************************************************************************976 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375759.5E-551136IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.101.1E-3445113IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.04349126IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.04E-3950130IPR004333Transcription factor, SBP-box
PfamPF031101.2E-3252125IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
METNKWEGKR SITEAEKEED EHGSVEEDSK RKRVLTLSGR KLVGEGSAHP SCQVDQCTAD  60
MADAKPYHRR HKVCEFHSKS PIVLISGLQK RFCQQCSRFH LLAEFDDAKR SCRRRLAGHN  120
ERRRKITYDS HGENLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-37521251184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.90541e-166floral bud| flower| fruit
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.
Function -- GeneRIF ? help Back to Top
  1. RIN recruitment to target loci is dependent on a normally functioning allele at the ripening-specific transcription factor COLORLESS NONRIPENING gene locus.[CNR]
    [PMID: 21941001]
  2. Findings reveal that working together with a ripening network of transcription factors, SlymiR157 and SlymiR156 form a critical additional layer of regulatory control over the fruit ripening process in tomato. [LeSPL-CNR]
    [PMID: 25597857]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00290DAPTransfer from AT2G33810Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc02g077920.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM1558951e-164Solanum lycopersicum isolate 71_P3CNRDseq genomic sequence
GenBankHM1558961e-164Solanum lycopersicum isolate 72_P3CNRDseq genomic sequence
GenBankHM1558971e-164Solanum lycopersicum isolate 74_P3CNRDseq genomic sequence
GenBankHM1558981e-164Solanum lycopersicum isolate 75_P3CNRDseq genomic sequence
GenBankHM1558991e-164Solanum lycopersicum isolate 76_P3CNRDseq genomic sequence
GenBankHM1559001e-164Solanum lycopersicum isolate 79_P3CNRDseq genomic sequence
GenBankHM1559011e-164Solanum lycopersicum isolate 81_P3CNRDseq genomic sequence
GenBankHM1559021e-164Solanum lycopersicum isolate 83_P3CNRDseq genomic sequence
GenBankHM1559031e-164Solanum lycopersicum isolate 82_P3CNRDseq genomic sequence
GenBankHM1559041e-164Solanum lycopersicum isolate 84_P3CNRDseq genomic sequence
GenBankHM1559051e-164Solanum lycopersicum isolate 85_P3CNRDseq genomic sequence
GenBankHM1559061e-164Solanum lycopersicum isolate 87_P3CNRDseq genomic sequence
GenBankHM1559071e-164Solanum lycopersicum isolate 88_P3CNRDseq genomic sequence
GenBankHM1559081e-164Solanum lycopersicum isolate 89_P3CNRDseq genomic sequence
GenBankHM1559091e-164Solanum lycopersicum isolate 90_P3CNRDseq genomic sequence
GenBankHM1559101e-164Solanum lycopersicum isolate 91_P3CNRDseq genomic sequence
GenBankHM1559111e-164Solanum lycopersicum isolate 92_P3CNRDseq genomic sequence
GenBankHM1559121e-164Solanum lycopersicum isolate 93_P3CNRDseq genomic sequence
GenBankHM1559131e-164Solanum lycopersicum isolate 94_P3CNRDseq genomic sequence
GenBankHM1559141e-164Solanum lycopersicum isolate 95_P3CNRDseq genomic sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001306237.11e-97SQUAMOSA promoter binding protein-like
RefseqXP_015063347.11e-97squamosa promoter-binding protein 1 isoform X1
SwissprotQ387413e-54SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLQ0PY353e-96Q0PY35_SOLLC; Squamosa promoter-binding-like protein
STRINGSolyc02g077920.2.14e-97(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74924105
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.12e-44squamosa promoter binding protein-like 3
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Manning K, et al.
    A naturally occurring epigenetic mutation in a gene encoding an SBP-box transcription factor inhibits tomato fruit ripening.
    Nat. Genet., 2006. 38(8): p. 948-52
    [PMID:16832354]
  3. Chen X, et al.
    SQUAMOSA promoter-binding protein-like transcription factors: star players for plant growth and development.
    J Integr Plant Biol, 2010. 52(11): p. 946-51
    [PMID:20977652]
  4. Martel C,Vrebalov J,Tafelmeyer P,Giovannoni JJ
    The tomato MADS-box transcription factor RIPENING INHIBITOR interacts with promoters involved in numerous ripening processes in a COLORLESS NONRIPENING-dependent manner.
    Plant Physiol., 2011. 157(3): p. 1568-79
    [PMID:21941001]
  5. Chen W, et al.
    Tuning LeSPL-CNR expression by SlymiR157 affects tomato fruit ripening.
    Sci Rep, 2015. 5: p. 7852
    [PMID:25597857]
  6. Klein J,Saedler H,Huijser P
    A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA.
    Mol. Gen. Genet., 1996. 250(1): p. 7-16
    [PMID:8569690]