PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc02g076850.1.1 | ||||||||
Common Name | LOC104645845 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 164aa MW: 18221.4 Da PI: 7.7702 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 122.8 | 1.2e-38 | 51 | 108 | 2 | 59 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk k Solyc02g076850.1.1 51 PDKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKAK 108 68999***************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 9.0E-30 | 50 | 108 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 4.0E-32 | 53 | 108 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.258 | 55 | 109 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 57 | 93 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:1902455 | Biological Process | negative regulation of stem cell population maintenance | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 164 aa Download sequence Send to blast |
MAEVQESPIS QGIKLFGATI EIQEKQAKAT HQPTNKVVVD DDDDNDQEKR PDKIIPCPRC 60 KSMETKFCYF NNYNVNQPRH FCKGCQRYWT AGGALRNVPV GAGRRKAKPP CGPGPHGDLA 120 DGCNLFDVAN QLDFDGSVVA HEDQWHLFPA AKRRRSTSDS QSY* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the vasculature of cotyledons and hypocotyls, leaves and roots. {ECO:0000269|PubMed:19619493}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc02g076850.1.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC215388 | 0.0 | Solanum lycopersicum chromosome 2 clone C02HBa0122E16, complete sequence |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010316809.1 | 1e-121 | dof zinc finger protein DOF1.5 | ||||
Swissprot | O22967 | 3e-51 | CDF4_ARATH; Cyclic dof factor 4 | ||||
TrEMBL | A0A3Q7FPW3 | 1e-120 | A0A3Q7FPW3_SOLLC; Uncharacterized protein | ||||
STRING | Solyc02g076850.1.1 | 1e-121 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA7240 | 22 | 32 | Representative plant | OGRP38 | 17 | 445 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G34140.1 | 2e-51 | Dof family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc02g076850.1.1 |
Entrez Gene | 104645845 |
Publications ? help Back to Top | |||
---|---|---|---|
|