PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g100200.2.1
Common NameGRAS4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 667aa    MW: 75737.7 Da    PI: 6.7624
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g100200.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS365.57.4e-1122866571374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l+ lL++cA+a+++ d + a++lL r++e+++p+gd ++Rla+y+++AL+arl+++++ ly a +ps+ s    ++ l+a+k+f  ++P+ 
  Solyc01g100200.2.1 286 LRALLTQCAQAMANYDSRTANELLMRIREHSTPHGDGTERLAHYLANALEARLSGTGTALYTAYAPSRIS---AANILKAYKAFIRACPFK 373
                         5789************************************************************999998...899*************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                          +s++ aN+ I + ++g+ ++HiiDf+i +G+QWp+L+q L+ R++gpp+lRiTg++ p++g   + ++eetg+rL+k+++++ vpf f++
  Solyc01g100200.2.1 374 LLSNIFANKYIRKVIAGAPKIHIIDFGILYGFQWPCLIQGLSMRAGGPPELRITGIDLPQPGfkPAGRVEETGRRLEKYCKRFSVPFVFKA 464
                         *************************************************************9999************************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          +ak++e+++leeL+v+++E+l+Vn+ ++l +++de+v  +s+rd+vL+l+++++P+++++   +   n++ F++rf eal ++s+l+d++
  Solyc01g100200.2.1 465 -IAKKWESITLEELEVQRDEVLVVNSLYRLGNIPDETVVPNSPRDAVLNLIRRIRPDLFIHGALNGTFNTPFFVTRFREALFHFSSLYDMF 554
                         .7***************************************************************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         ea+lpre+e+r+  E+e+++r+++nv+aceg+er+er et+++W+ r  +aGFk+vpl+++++k ++  +r  + + ++v+e+ +++++gW
  Solyc01g100200.2.1 555 EATLPREDEDRKLFEEEVFARDAMNVIACEGTERVERPETYKQWQLRCVRAGFKQVPLDQEIVKIVRNKVRSEYHRDFSVDEDGHWMLQGW 645
                         **************************************************************************999************** PP

                GRAS 363 kdrpLvsvSaWr 374
                         k+r ++++S+W+
  Solyc01g100200.2.1 646 KGRVIYALSCWK 657
                         ***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.899260637IPR005202Transcription factor GRAS
PfamPF035142.6E-109286657IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 667 aa     Download sequence    Send to blast
MEALFQEQLF PCADSFIFRH PSIPMDPRKE VIQNGLNNHP SFDQDYFSNH VVGVGDSSPP  60
PQEEGEKDYS DAMYKFLSQM LMEEDDLENK PCMFHDCMAL QAKERYLSDV LHGSENNYSP  120
QSVIINPHDS SSFLSNYSPD SIESPQWDLN FESPASMSTL SNHDSFFTSF GNGHFEEGAV  180
NVLQSGSSSN SPTGLREKKN RHRGDVAADQ QRSNKQMATF VHDESEPLEM YDNVLLCLNN  240
PYVEQHSATS ITSYSPPNEA KKTSKVGRPR GGRKHSSIVK KEMVDLRALL TQCAQAMANY  300
DSRTANELLM RIREHSTPHG DGTERLAHYL ANALEARLSG TGTALYTAYA PSRISAANIL  360
KAYKAFIRAC PFKLLSNIFA NKYIRKVIAG APKIHIIDFG ILYGFQWPCL IQGLSMRAGG  420
PPELRITGID LPQPGFKPAG RVEETGRRLE KYCKRFSVPF VFKAIAKKWE SITLEELEVQ  480
RDEVLVVNSL YRLGNIPDET VVPNSPRDAV LNLIRRIRPD LFIHGALNGT FNTPFFVTRF  540
REALFHFSSL YDMFEATLPR EDEDRKLFEE EVFARDAMNV IACEGTERVE RPETYKQWQL  600
RCVRAGFKQV PLDQEIVKIV RNKVRSEYHR DFSVDEDGHW MLQGWKGRVI YALSCWKPTK  660
QSVKLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B2e-4228865989475Protein SHORT-ROOT
5b3h_B6e-4328865935421Protein SHORT-ROOT
5b3h_E6e-4328865935421Protein SHORT-ROOT
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.91040.0callus| flower| fruit| leaf| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc01g100200.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2385030.0Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-10f3 map 1, complete sequence
GenBankAC2389200.0Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-222e21 map 1, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234310.10.0GRAS4 isoform 1
TrEMBLQ00LP50.0Q00LP5_SOLLC; GRAS4
STRINGSolyc01g100200.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.10.0GRAS family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Mayrose M,Ekengren SK,Melech-Bonfil S,Martin GB,Sessa G
    A novel link between tomato GRAS genes, plant disease resistance and mechanical stress response.
    Mol. Plant Pathol., 2006. 7(6): p. 593-604
    [PMID:20507472]