PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc01g096320.2.1 | ||||||||
Common Name | LOC101262661 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 240aa MW: 27267.2 Da PI: 4.9259 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 59.7 | 4.6e-19 | 45 | 96 | 5 | 56 |
SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 ++f++eq++ Le++Fe + ++ +++ +LA++lgL+ rqV +WFqN+Ra++k Solyc01g096320.2.1 45 RRFSDEQIKSLETMFETETKLEPRKKLQLARELGLQPRQVAIWFQNKRARWK 96 48*************************************************9 PP | |||||||
2 | HD-ZIP_I/II | 124.5 | 4.9e-40 | 44 | 134 | 3 | 93 |
HD-ZIP_I/II 3 krrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 rr+s+eq+k+LE++Fe+e+kLep++K +lareLglqprqva+WFqn+RAR+k+kqlE+dy+ Lk++yd+l+++ e+L+ke+++L +l++ Solyc01g096320.2.1 44 ARRFSDEQIKSLETMFETETKLEPRKKLQLARELGLQPRQVAIWFQNKRARWKSKQLERDYSILKSNYDNLASQYEALKKEKQSLLIQLQK 134 69***********************************************************************************999986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 9.19E-19 | 22 | 100 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 16.52 | 38 | 98 | IPR001356 | Homeobox domain |
SMART | SM00389 | 7.9E-16 | 41 | 102 | IPR001356 | Homeobox domain |
CDD | cd00086 | 1.82E-15 | 45 | 99 | No hit | No description |
Pfam | PF00046 | 1.9E-16 | 45 | 96 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-19 | 45 | 105 | IPR009057 | Homeodomain-like |
PRINTS | PR00031 | 9.7E-6 | 69 | 78 | IPR000047 | Helix-turn-helix motif |
PROSITE pattern | PS00027 | 0 | 73 | 96 | IPR017970 | Homeobox, conserved site |
PRINTS | PR00031 | 9.7E-6 | 78 | 94 | IPR000047 | Helix-turn-helix motif |
Pfam | PF02183 | 5.2E-17 | 98 | 138 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009414 | Biological Process | response to water deprivation | ||||
GO:0009738 | Biological Process | abscisic acid-activated signaling pathway | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 240 aa Download sequence Send to blast |
MFDTGEFSPS SSTAAVSAEC FSSSSCFSSL SSSKKKKIHS SNNARRFSDE QIKSLETMFE 60 TETKLEPRKK LQLARELGLQ PRQVAIWFQN KRARWKSKQL ERDYSILKSN YDNLASQYEA 120 LKKEKQSLLI QLQKLKEIES DNRCSVIKKN EMEGMPSLSF DLSSQHGTNG VMSDDDIDSS 180 IRADYLGLDD DAEYHLLKIV ETGDSSLTSP ENWGCLDDDG ILNHQPNSSS YDQWWDFWS* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Les.9534 | 0.0 | fruit| leaf |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:8771791}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator that may act as growth regulators in response to water deficit. {ECO:0000269|PubMed:15604708, ECO:0000269|PubMed:8771791}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00320 | DAP | Transfer from AT2G46680 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc01g096320.2.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By water deficit, by abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:8771791}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP009261 | 3e-10 | Solanum lycopersicum genomic DNA, chromosome 8, clone: C08HBa0005L01, complete sequence |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004230017.1 | 1e-176 | homeobox-leucine zipper protein ATHB-12 | ||||
Swissprot | P46897 | 6e-65 | ATHB7_ARATH; Homeobox-leucine zipper protein ATHB-7 | ||||
TrEMBL | A0A3Q7EMS0 | 1e-175 | A0A3Q7EMS0_SOLLC; Uncharacterized protein | ||||
STRING | Solyc01g096320.2.1 | 1e-175 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2041 | 23 | 63 | Representative plant | OGRP129 | 16 | 189 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G46680.2 | 6e-50 | homeobox 7 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc01g096320.2.1 |
Entrez Gene | 101262661 |
Publications ? help Back to Top | |||
---|---|---|---|
|