PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc01g060490.2.1 | ||||||||
Common Name | LOC101265163 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 172aa MW: 18569.7 Da PI: 8.5827 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 60.5 | 2.1e-19 | 68 | 101 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 C+nCg+ kTplWR+gp g+k+LCnaCG++ rkk+ Solyc01g060490.2.1 68 CVNCGAMKTPLWRSGPAGPKSLCNACGIRSRKKK 101 ********************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50114 | 12.611 | 62 | 98 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 2.6E-12 | 62 | 112 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 4.75E-13 | 65 | 102 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 3.6E-16 | 67 | 102 | IPR013088 | Zinc finger, NHR/GATA-type |
PROSITE pattern | PS00344 | 0 | 68 | 93 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 1.1E-16 | 68 | 102 | IPR000679 | Zinc finger, GATA-type |
CDD | cd00202 | 3.72E-14 | 68 | 102 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0045944 | Biological Process | positive regulation of transcription from RNA polymerase II promoter | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005667 | Cellular Component | transcription factor complex | ||||
GO:0000977 | Molecular Function | RNA polymerase II regulatory region sequence-specific DNA binding | ||||
GO:0001085 | Molecular Function | RNA polymerase II transcription factor binding | ||||
GO:0001228 | Molecular Function | transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding | ||||
GO:0003682 | Molecular Function | chromatin binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 172 aa Download sequence Send to blast |
MDLTDKVIGS EATEMTTPEV MISSEMEVKA AEMMISPEIK AKAPEVISSE IQMKTPEVIS 60 SEIQMKNCVN CGAMKTPLWR SGPAGPKSLC NACGIRSRKK KRDLLGLNKD EKKTKKSSAN 120 SASSSNVDKK KKKKICAVKN ADAIPIHWTD LDDVEQAAFL LMCLSCSSVC A* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc01g060490.2.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010318767.1 | 1e-120 | GATA transcription factor 16 | ||||
TrEMBL | A0A3Q7EYP7 | 1e-108 | A0A3Q7EYP7_SOLLC; Uncharacterized protein | ||||
STRING | Solyc01g060490.2.1 | 1e-119 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1999 | 23 | 62 | Representative plant | OGRP68 | 17 | 287 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G49300.1 | 2e-19 | GATA transcription factor 16 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc01g060490.2.1 |
Entrez Gene | 101265163 |
Publications ? help Back to Top | |||
---|---|---|---|
|