PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc01g060300.1.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 212aa MW: 23122.6 Da PI: 9.3583 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 71.8 | 6.1e-23 | 14 | 59 | 2 | 47 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47 +i+n++n qvt+skRr+g++KKA+ELS+LC+a+va++ fs+++k+y Solyc01g060300.1.1 14 KIQNQTNLQVTLSKRRAGLFKKASELSTLCGANVAIVAFSPSNKVY 59 79******************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.1E-30 | 5 | 64 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 23.661 | 5 | 65 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 5.62E-26 | 6 | 80 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.56E-33 | 6 | 73 | No hit | No description |
PRINTS | PR00404 | 2.2E-18 | 7 | 27 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.4E-23 | 14 | 59 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.2E-18 | 27 | 42 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.2E-18 | 42 | 63 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 212 aa Download sequence Send to blast |
MRKPNGRKKI EIAKIQNQTN LQVTLSKRRA GLFKKASELS TLCGANVAIV AFSPSNKVYA 60 CGHPSVESIV DKFIGENPPP ETDDPNPIIV MTADTIPKGS PFTSMQEFSL GIDFGKLCQI 120 TCVPQLIESC PNSSILQIWT DYHLGSTNEL AHQALLDLGG YRLVILPLHR AGTVRCSVKP 180 ASRSPFHFRN PSAHSFDWIA RPNSMLGQGR P* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3kov_A | 1e-16 | 6 | 89 | 1 | 84 | Myocyte-specific enhancer factor 2A |
3kov_B | 1e-16 | 6 | 89 | 1 | 84 | Myocyte-specific enhancer factor 2A |
3kov_I | 1e-16 | 6 | 89 | 1 | 84 | Myocyte-specific enhancer factor 2A |
3kov_J | 1e-16 | 6 | 89 | 1 | 84 | Myocyte-specific enhancer factor 2A |
3p57_A | 1e-16 | 6 | 89 | 1 | 84 | Myocyte-specific enhancer factor 2A |
3p57_B | 1e-16 | 6 | 89 | 1 | 84 | Myocyte-specific enhancer factor 2A |
3p57_C | 1e-16 | 6 | 89 | 1 | 84 | Myocyte-specific enhancer factor 2A |
3p57_D | 1e-16 | 6 | 89 | 1 | 84 | Myocyte-specific enhancer factor 2A |
3p57_I | 1e-16 | 6 | 89 | 1 | 84 | Myocyte-specific enhancer factor 2A |
3p57_J | 1e-16 | 6 | 89 | 1 | 84 | Myocyte-specific enhancer factor 2A |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc01g060300.1.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC240193 | 1e-134 | Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-152e17 map 1, complete sequence |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
STRING | Solyc01g060300.1.1 | 1e-156 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA18460 | 2 | 4 | Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60440.1 | 1e-29 | AGAMOUS-like 62 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc01g060300.1.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|