PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g009070.2.1
Common NameLOC100037511
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB
Protein Properties Length: 538aa    MW: 58773.8 Da    PI: 4.9031
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g009070.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.3e-163683148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT  Ed +lvd+v  +G g+W+++ r+ g+ R++k+c++rw ++l
  Solyc01g009070.2.1 36 KGPWTSAEDVILVDYVMTHGEGNWNAVQRHSGLARCGKSCRLRWANHL 83
                        79******************************************9986 PP

2Myb_DNA-binding537.6e-1789132146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         +g++T+eE++++v++++++G++ W++ a +++ gRt++++k++w++
  Solyc01g009070.2.1  89 KGAFTPEEEQRIVELHAKMGNK-WARMAVELP-GRTDNEIKNYWNT 132
                         799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.9373183IPR017930Myb domain
SuperFamilySSF466898.59E-2933130IPR009057Homeodomain-like
SMARTSM007171.5E-123585IPR001005SANT/Myb domain
PfamPF002494.9E-143683IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-233790IPR009057Homeodomain-like
CDDcd001675.82E-103883No hitNo description
PROSITE profilePS5129425.44584138IPR017930Myb domain
SMARTSM007177.7E-1688136IPR001005SANT/Myb domain
PfamPF002493.3E-1589132IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-2591137IPR009057Homeodomain-like
CDDcd001671.71E-1191132No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0009010anatomyseed
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MSIKSETEER MTSKVDMDSP DEASGGDLGE SVPLKKGPWT SAEDVILVDY VMTHGEGNWN  60
AVQRHSGLAR CGKSCRLRWA NHLRPDLKKG AFTPEEEQRI VELHAKMGNK WARMAVELPG  120
RTDNEIKNYW NTRIKRRQRA GLPIYPADIS FMASQNKQNE ELGAFSSADA QNPDVLGINN  180
FEIPAVEFKK LELTHLLYPP QLADIPARSL LNDPVSNFLS QGHRAPYSST YFLSTTYPAK  240
RIRGSESVFS GSNGDLLNSL QYQNDGSLLA QAQAQPLDFS SYNHNLTYDD QRAISNIVPG  300
GHAYLNGNSS SEPTWAMKLE LPSLQNQTEN WGSPHSALPS LDSVDILIQS PPAGHSESGS  360
LSPSNSGLLD AVLHESQTMK ASNDNSYQGN ETSGNAVNNS CPDLKGCDIY GHPVSPLSQF  420
SASVFSDYAP INESSLHEFP SMATMPGGEI KQEIGDLSPL DDEDNTSNQT IFSSPKTQHA  480
NNHLASKDPF GSCFFDDCDW DCKQIHAVTT SSGQANGHNS CSWDAISAME ATGRMRL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-29341375107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.193250.0leaf
Function -- GeneRIF ? help Back to Top
  1. LeGAMYBL1 expression increases during germination, upregulated by gibberellic acid GA(3), declines thereafter. GA(3) not required for expression. abscisic acid does not influence expression. Expression also occurs in the endosperm. [LeGAMYBL1]
    [PMID: 18542997]
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc01g009070.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1754740.0Solanum lycopersicum GAMyb-like1 mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234357.20.0GAMyb-like1
RefseqXP_010319228.10.0GAMyb-like1 isoform X1
RefseqXP_010322046.10.0GAMyb-like1 isoform X1
RefseqXP_010324959.10.0GAMyb-like1 isoform X1
TrEMBLA0A3Q7E9E50.0A0A3Q7E9E5_SOLLC; Uncharacterized protein
STRINGSolyc01g009070.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20212358
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.12e-75myb domain protein 33
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Gong X,Bewley DJ
    A GAMYB-like gene in tomato and its expression during seed germination.
    Planta, 2008. 228(4): p. 563-72
    [PMID:18542997]