PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Seita.9G113200.2.p | ||||||||
Common Name | LOC101773223, SETIT_037256mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 239aa MW: 27176 Da PI: 6.9443 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.2 | 3.7e-18 | 4 | 49 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ede+l+++v+++G+++W++Ia++++ gR++k+c++rw++ Seita.9G113200.2.p 4 RGHWRPSEDEKLKELVALYGPHNWNAIAEKLQ-GRSGKSCRLRWFNQ 49 899*****************************.***********996 PP | |||||||
2 | Myb_DNA-binding | 52.5 | 1.1e-16 | 56 | 99 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 r ++++eE+ell+ ++ +G++ W+ Iar ++ gRt++ +k++w+ Seita.9G113200.2.p 56 RSPFSEEEEELLLASHRVHGNR-WAVIARLFP-GRTDNAVKNHWHV 99 789*******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 25.97 | 1 | 54 | IPR017930 | Myb domain |
SMART | SM00717 | 1.5E-15 | 3 | 52 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.0E-18 | 4 | 49 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 5.24E-29 | 4 | 97 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 9.6E-27 | 5 | 57 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.32E-13 | 7 | 48 | No hit | No description |
PROSITE profile | PS51294 | 19.902 | 55 | 105 | IPR017930 | Myb domain |
SMART | SM00717 | 4.5E-15 | 55 | 103 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.8E-14 | 56 | 98 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.1E-20 | 58 | 104 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.35E-5 | 71 | 98 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:2000652 | Biological Process | regulation of secondary cell wall biogenesis | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 239 aa Download sequence Send to blast |
MCTRGHWRPS EDEKLKELVA LYGPHNWNAI AEKLQGRSGK SCRLRWFNQL DPRINRSPFS 60 EEEEELLLAS HRVHGNRWAV IARLFPGRTD NAVKNHWHVI MARRCRERMR MSNKRGAGGV 120 PSAAAAGAAE DENNPRNAKR PRPDSSSMAS LLDKYRREFA VPFAINHDSN KEDYCSTTNE 180 EDTNKSVEFY DFLQVNANSS DTKCGSSIEE QEENRDDQAE GQVQFIDFLE VGAASHRQ* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-33 | 2 | 105 | 5 | 108 | B-MYB |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 138 | 142 | KRPRP |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:23781226}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00145 | DAP | Transfer from AT1G17950 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Seita.9G113200.2.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19674407, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:22197883}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ728192 | 0.0 | KJ728192.1 Zea mays clone pUT6466 MYB transcription factor (MYB37) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004981954.1 | 1e-179 | transcription factor MYB52 isoform X2 | ||||
Swissprot | Q6R0C4 | 2e-76 | MYB52_ARATH; Transcription factor MYB52 | ||||
TrEMBL | A0A368SFL6 | 1e-178 | A0A368SFL6_SETIT; Uncharacterized protein | ||||
STRING | Si037256m | 1e-157 | (Setaria italica) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G73410.1 | 2e-70 | myb domain protein 54 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Seita.9G113200.2.p |
Entrez Gene | 101773223 |
Publications ? help Back to Top | |||
---|---|---|---|
|