PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.8G135700.4.p
Common NameLOC101781693, SETIT_025988mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family ARF
Protein Properties Length: 812aa    MW: 90033.3 Da    PI: 7.052
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.8G135700.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.13.4e-23112213199
                         EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                         f+k+lt sd++++g +++ +++a+e+      + + + +++l+ +d++g +W++++i+r++++r++l++GW+ Fv+a++L +gD ++F   
  Seita.8G135700.4.p 112 FCKTLTASDTSTHGGFSVLRRHADEClppldmSRQ-PPTQELVAKDLHGAEWRFRHIFRGQPRRHLLQSGWSVFVSAKRLVAGDAFIFL-- 199
                         99*****************************7333.34459************************************************.. PP

                         SSSEE..EEEEE-S CS
                  B3  86 grsefelvvkvfrk 99 
                         +  ++el+v+v+r+
  Seita.8G135700.4.p 200 RGVNGELRVGVRRA 213
                         4489999****996 PP

2Auxin_resp105.85.1e-35238320183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a+ha++t+++F+v+Y+Pr+s++eFvv++++++++lk+++ +GmRfkm+fe+e+++e+r++Gt+vg  d d+  Wp+SkWr Lk
  Seita.8G135700.4.p 238 AWHAVNTGTMFTVYYKPRTSPAEFVVPCDRYMESLKRNYPIGMRFKMRFEGEEAPEQRFTGTIVGNVDPDQAGWPESKWRYLK 320
                         89******************************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.108.8E-42104227IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.67E-40105241IPR015300DNA-binding pseudobarrel domain
CDDcd100173.68E-21110212No hitNo description
SMARTSM010192.6E-23112214IPR003340B3 DNA binding domain
PfamPF023623.6E-21112213IPR003340B3 DNA binding domain
PROSITE profilePS5086311.519112214IPR003340B3 DNA binding domain
PfamPF065071.4E-32238320IPR010525Auxin response factor
PROSITE profilePS5174521.208686768IPR000270PB1 domain
SuperFamilySSF542772.89E-11687762No hitNo description
PfamPF023097.6E-8727771IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009737Biological Processresponse to abscisic acid
GO:0009911Biological Processpositive regulation of flower development
GO:0010047Biological Processfruit dehiscence
GO:0010150Biological Processleaf senescence
GO:0010227Biological Processfloral organ abscission
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 812 aa     Download sequence    Send to blast
MYTELWNLCA GPLVTVPSVG DKVYYFPQGH IEQVEASTNQ VAEQHMQLYN LPWKILCEVM  60
NVELKAEPDT DEVYAQLTLL PESKQPDENG SSEQEMPAAP SAAPARPRVH SFCKTLTASD  120
TSTHGGFSVL RRHADECLPP LDMSRQPPTQ ELVAKDLHGA EWRFRHIFRG QPRRHLLQSG  180
WSVFVSAKRL VAGDAFIFLR GVNGELRVGV RRAMRQQANV PSSVISSHSM HLGVLATAWH  240
AVNTGTMFTV YYKPRTSPAE FVVPCDRYME SLKRNYPIGM RFKMRFEGEE APEQRFTGTI  300
VGNVDPDQAG WPESKWRYLK VRWDEASSIP RPERVSPWQI EPAVSPPPIN PLPVHRPKRP  360
RSNAVASLPD SSAPTKEAAP KVTVEAQQNA LQRVLQTQDN ATPKSAFGDK SELDAAQQSV  420
LRPSGFDREK STIGTQRKLG SDSWMQMSRP ESYNEMLSGL SGYQQPKDLQ NQQGFCSLPD  480
QIAAGRPNFW HTVNAHYQDQ QGNHNMFGSW SMMPSSTGFG LNRQNYPMIQ EVGAMPQSSA  540
NTKFGNGVYT PLPGRGIDQY SAGWFGHMVP GSRMDDAQPR VIKPQPLVLA HGDAQKMKGN  600
SCKLFGIHLD SPAKSEPLKS PPSVANDGMP QTPAAAEWRR VDTTEVEKSS DPPKTPKQLD  660
APQADPVPCP QSSRSTQCKS QGGSTRSCKK VHKQGIALGR SVDLTKFKGY TELVSELDEM  720
FDFNGELKGS NKEWMVVYTD NEGDMMLVGD DPWDEFCNMV HKIFIYTTEE VQRMNPGTLN  780
SGSEDSPANS MERGSAVRET LPASSLNSGN C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-170434222354Auxin response factor 1
4ldw_A1e-170434222354Auxin response factor 1
4ldw_B1e-170434222354Auxin response factor 1
4ldx_A1e-170434222354Auxin response factor 1
4ldx_B1e-170434222354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00574DAPTransfer from AT5G62000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.8G135700.4.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022684732.10.0auxin response factor 23 isoform X1
RefseqXP_022684733.10.0auxin response factor 23 isoform X1
SwissprotA2ZET60.0ARFW_ORYSI; Auxin response factor 23
TrEMBLK3ZHD60.0K3ZHD6_SETIT; Auxin response factor
STRINGSi025988m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2