PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.8G135700.2.p
Common NameLOC101781693, SETIT_025988mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family ARF
Protein Properties Length: 811aa    MW: 89905.2 Da    PI: 7.052
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.8G135700.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.13.4e-23111212199
                         EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                         f+k+lt sd++++g +++ +++a+e+      + + + +++l+ +d++g +W++++i+r++++r++l++GW+ Fv+a++L +gD ++F   
  Seita.8G135700.2.p 111 FCKTLTASDTSTHGGFSVLRRHADEClppldmSRQ-PPTQELVAKDLHGAEWRFRHIFRGQPRRHLLQSGWSVFVSAKRLVAGDAFIFL-- 198
                         99*****************************7333.34459************************************************.. PP

                         SSSEE..EEEEE-S CS
                  B3  86 grsefelvvkvfrk 99 
                         +  ++el+v+v+r+
  Seita.8G135700.2.p 199 RGVNGELRVGVRRA 212
                         4489999****996 PP

2Auxin_resp105.85.1e-35237319183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a+ha++t+++F+v+Y+Pr+s++eFvv++++++++lk+++ +GmRfkm+fe+e+++e+r++Gt+vg  d d+  Wp+SkWr Lk
  Seita.8G135700.2.p 237 AWHAVNTGTMFTVYYKPRTSPAEFVVPCDRYMESLKRNYPIGMRFKMRFEGEEAPEQRFTGTIVGNVDPDQAGWPESKWRYLK 319
                         89******************************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.108.8E-42103226IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.67E-40104240IPR015300DNA-binding pseudobarrel domain
CDDcd100173.67E-21109211No hitNo description
PROSITE profilePS5086311.519111213IPR003340B3 DNA binding domain
SMARTSM010192.6E-23111213IPR003340B3 DNA binding domain
PfamPF023623.6E-21111212IPR003340B3 DNA binding domain
PfamPF065071.4E-32237319IPR010525Auxin response factor
PROSITE profilePS5174521.208685767IPR000270PB1 domain
SuperFamilySSF542772.89E-11686761No hitNo description
PfamPF023097.6E-8726770IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009737Biological Processresponse to abscisic acid
GO:0009911Biological Processpositive regulation of flower development
GO:0010047Biological Processfruit dehiscence
GO:0010150Biological Processleaf senescence
GO:0010227Biological Processfloral organ abscission
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 811 aa     Download sequence    Send to blast
MYTELWNLCA GPLVTVPSVG DKVYYFPQGH IEQVEASTNQ VAEQHMQLYN LPWKILCEVM  60
NVELKAEPDT DEVYAQLTLL PESKPDENGS SEQEMPAAPS AAPARPRVHS FCKTLTASDT  120
STHGGFSVLR RHADECLPPL DMSRQPPTQE LVAKDLHGAE WRFRHIFRGQ PRRHLLQSGW  180
SVFVSAKRLV AGDAFIFLRG VNGELRVGVR RAMRQQANVP SSVISSHSMH LGVLATAWHA  240
VNTGTMFTVY YKPRTSPAEF VVPCDRYMES LKRNYPIGMR FKMRFEGEEA PEQRFTGTIV  300
GNVDPDQAGW PESKWRYLKV RWDEASSIPR PERVSPWQIE PAVSPPPINP LPVHRPKRPR  360
SNAVASLPDS SAPTKEAAPK VTVEAQQNAL QRVLQTQDNA TPKSAFGDKS ELDAAQQSVL  420
RPSGFDREKS TIGTQRKLGS DSWMQMSRPE SYNEMLSGLS GYQQPKDLQN QQGFCSLPDQ  480
IAAGRPNFWH TVNAHYQDQQ GNHNMFGSWS MMPSSTGFGL NRQNYPMIQE VGAMPQSSAN  540
TKFGNGVYTP LPGRGIDQYS AGWFGHMVPG SRMDDAQPRV IKPQPLVLAH GDAQKMKGNS  600
CKLFGIHLDS PAKSEPLKSP PSVANDGMPQ TPAAAEWRRV DTTEVEKSSD PPKTPKQLDA  660
PQADPVPCPQ SSRSTQCKSQ GGSTRSCKKV HKQGIALGRS VDLTKFKGYT ELVSELDEMF  720
DFNGELKGSN KEWMVVYTDN EGDMMLVGDD PWDEFCNMVH KIFIYTTEEV QRMNPGTLNS  780
GSEDSPANSM ERGSAVRETL PASSLNSGNC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-170434122354Auxin response factor 1
4ldw_A1e-170434122354Auxin response factor 1
4ldw_B1e-170434122354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00574DAPTransfer from AT5G62000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.8G135700.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022684734.10.0auxin response factor 23 isoform X2
SwissprotA2ZET60.0ARFW_ORYSI; Auxin response factor 23
TrEMBLK3ZHD70.0K3ZHD7_SETIT; Auxin response factor
STRINGSi025988m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2