PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Seita.7G285100.1.p | ||||||||
Common Name | LOC101782901, SETIT_012017mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 221aa MW: 24047 Da PI: 8.5864 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.6 | 1.2e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++lv ++k +G g+W++ ++ g+ R++k+c++rw +yl Seita.7G285100.1.p 14 KGAWTKEEDQRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 58.7 | 1.3e-18 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T+eEd+l++++++ lG++ W+ Ia +++ gRt++++k++w+++ Seita.7G285100.1.p 67 RGNFTEEEDDLIIKLHQILGNK-WSQIAGRLP-GRTDNEIKNYWNTH 111 89********************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 4.2E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 16.922 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.29E-30 | 13 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.2E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.2E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.17E-11 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 28.414 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.2E-28 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.9E-18 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.7E-17 | 67 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.87E-13 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 221 aa Download sequence Send to blast |
MGRSPCCEKA HTNKGAWTKE EDQRLVAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWINY 60 LRPDLKRGNF TEEEDDLIIK LHQILGNKWS QIAGRLPGRT DNEIKNYWNT HIKRKLLARG 120 IDPKTHRPLS VTAAAAAAPS SRPEDQPAAR SSCSPETSGA CCHNSDDDSV SAPHHGGIDL 180 NLAISPPRDP PSPSPLPTAT QEAEATSSAT VEETTPTRKS * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-31 | 14 | 116 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269|PubMed:11080161}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Seita.7G285100.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269|PubMed:11080161}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM156905 | 1e-155 | AM156905.1 Zea mays mRNA for transcription factor MYB8 (myb8 gene). | |||
GenBank | EU963911 | 1e-155 | EU963911.1 Zea mays clone 274019 hypothetical protein mRNA, complete cds. | |||
GenBank | HQ858692 | 1e-155 | HQ858692.1 Zea mays clone UT1148 ZmMYB8 transcription factor mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004977237.1 | 1e-161 | myb-related protein Zm38 | ||||
Swissprot | Q9SZP1 | 2e-88 | MYB4_ARATH; Transcription repressor MYB4 | ||||
TrEMBL | K3YCR7 | 1e-160 | K3YCR7_SETIT; Uncharacterized protein | ||||
STRING | Si012017m | 1e-161 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP116 | 37 | 448 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G38620.1 | 2e-88 | myb domain protein 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Seita.7G285100.1.p |
Entrez Gene | 101782901 |