PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Seita.7G035500.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
|
||||||||
Family | TCP | ||||||||
Protein Properties | Length: 95aa MW: 9743.92 Da PI: 4.2682 | ||||||||
Description | TCP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCP | 68.4 | 2.4e-21 | 2 | 47 | 28 | 73 |
TCP 28 caarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 +aar+F+L++eLG+ +d++tieWLl+qa+p+i+++tgt+ +++++ Seita.7G035500.1.p 2 VAARVFQLTRELGHRTDGETIEWLLRQAEPSIIAATGTGVTPEEAP 47 8*************************************77776333 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51369 | 19.483 | 1 | 36 | IPR017887 | Transcription factor TCP subgroup |
Pfam | PF03634 | 8.5E-17 | 2 | 61 | IPR005333 | Transcription factor, TCP |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 95 aa Download sequence Send to blast |
MVAARVFQLT RELGHRTDGE TIEWLLRQAE PSIIAATGTG VTPEEAPSAL VPVSPAAATA 60 SLMHVPYYTA LLMQPPPTAD SASGSGAAAE ENNN* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Seita.7G035500.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK372737 | 1e-58 | AK372737.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3010N16. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004975168.1 | 8e-61 | transcription factor PCF1-like | ||||
Swissprot | O23875 | 1e-34 | PCF1_ORYSJ; Transcription factor PCF1 | ||||
TrEMBL | A0A368RRG9 | 2e-60 | A0A368RRG9_SETIT; Uncharacterized protein | ||||
STRING | GRMZM2G096610_P01 | 7e-47 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP14172 | 26 | 27 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G23280.1 | 1e-21 | TCP family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Seita.7G035500.1.p |