PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Seita.5G391300.1.p | ||||||||
Common Name | LOC101780558, SETIT_003047mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 186aa MW: 21232.6 Da PI: 9.6231 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 21.5 | 5.5e-07 | 26 | 63 | 3 | 38 |
SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlk 38 +W++ Ed+ + a +++ g +W+++a+ ++ gRt+ Seita.5G391300.1.p 26 PWSKAEDKVFESALVMWPEGapdRWALVAAQLP-GRTPR 63 8********************************.***86 PP | |||||||
2 | Myb_DNA-binding | 44.9 | 2.6e-14 | 118 | 162 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ l++++ +++G g+W+ I+r +Rt+ q+ s+ qky Seita.5G391300.1.p 118 AWTEEEHRLFLQGLERYGRGDWRNISRFSVRTRTPAQVASHAQKY 162 6*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 8.156 | 19 | 77 | IPR017930 | Myb domain |
SMART | SM00717 | 8.2E-4 | 23 | 75 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 3.73E-10 | 25 | 72 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 3.2E-5 | 25 | 70 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.1E-5 | 26 | 63 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.17E-4 | 26 | 64 | No hit | No description |
PROSITE profile | PS51294 | 18.743 | 111 | 167 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.01E-17 | 112 | 165 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.4E-10 | 115 | 165 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 8.7E-17 | 116 | 165 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 1.1E-11 | 118 | 162 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.2E-11 | 118 | 167 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.34E-11 | 118 | 163 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 186 aa Download sequence Send to blast |
MDFQHQHHHH HRSVLAAGPP EVAVRPWSKA EDKVFESALV MWPEGAPDRW ALVAAQLPGR 60 TPREAWEHYE ALVADVDLIE RGAVDVPTSW DDDDDAGGPT RRPGANRARR EPRRTGIAWT 120 EEEHRLFLQG LERYGRGDWR NISRFSVRTR TPAQVASHAQ KYFNRRLNPA SRDSKRKSIH 180 DITTP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 4e-15 | 25 | 88 | 9 | 72 | RADIALIS |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Seita.5G391300.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004970674.1 | 1e-133 | transcription factor DIVARICATA | ||||
Swissprot | Q8S9H7 | 7e-43 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | K3XMC4 | 1e-132 | K3XMC4_SETIT; Uncharacterized protein | ||||
STRING | Si003047m | 1e-132 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2895 | 36 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04760.1 | 2e-47 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Seita.5G391300.1.p |
Entrez Gene | 101780558 |
Publications ? help Back to Top | |||
---|---|---|---|
|