PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G321300.3.p
Common NameLOC101782847, SETIT_000545mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family ARF
Protein Properties Length: 574aa    MW: 63169.2 Da    PI: 8.429
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G321300.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B378.28.7e-2516117199
                         EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                         f+k+lt sd++++g +++p++ ae++       ++ +  s++l+ +d++g +W++++iyr++++r++lt+GW++Fv+ ++L +gD v+F  
  Seita.5G321300.3.p  16 FCKTLTASDTSTHGGFSVPRRAAEDCfppldynQLRP--SQELVAKDLHGAKWKFRHIYRGQPRRHLLTTGWSSFVHKKKLVSGDAVLFL- 103
                         99****************************9876665..459************************************************. PP

                         -SSSEE..EEEEE-S CS
                  B3  85 dgrsefelvvkvfrk 99 
                          + +++el+++v+r+
  Seita.5G321300.3.p 104 -RGDDGELRLGVRRA 117
                         .3489999***9986 PP

2Auxin_resp91.91.1e-30144222382
          Auxin_resp   3 haastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                         ++++++svF++ YnPra++se++++++k+ k+l+++v++G R+ ++  +ed+serr sG+vvg+s++d+v+Wp+SkWrsL
  Seita.5G321300.3.p 144 DSLEHRSVFHISYNPRATASEYIIPYRKFIKSLNRPVCIGARINFQCHNEDVSERR-SGMVVGISEVDSVKWPGSKWRSL 222
                         57899***************************************************.9********************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.44E-445154IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.5E-3811117IPR015300DNA-binding pseudobarrel domain
CDDcd100173.30E-2314116No hitNo description
SMARTSM010193.2E-2416118IPR003340B3 DNA binding domain
PfamPF023621.0E-2216117IPR003340B3 DNA binding domain
PROSITE profilePS5086313.32416118IPR003340B3 DNA binding domain
PfamPF065079.3E-26145222IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 574 aa     Download sequence    Send to blast
MEDLDAERKS RMLHMFCKTL TASDTSTHGG FSVPRRAAED CFPPLDYNQL RPSQELVAKD  60
LHGAKWKFRH IYRGQPRRHL LTTGWSSFVH KKKLVSGDAV LFLRGDDGEL RLGVRRAIQL  120
KNEALFEDFS SDSAKRHTLS DVYDSLEHRS VFHISYNPRA TASEYIIPYR KFIKSLNRPV  180
CIGARINFQC HNEDVSERRS GMVVGISEVD SVKWPGSKWR SLLVRWEDGS ECNGQDRVSP  240
WEIEIVGGSV SVAHSLSASS SKRTKLCPQG NLDVPTMYVA GNGCTDSVET GKLPRVLQGQ  300
ELMGFRTHRV TCAPQTAEVA KFQSSDASRF LTNARSCMLS GPTSRLAVQN TSFTYQSVGF  360
NESIGFSEVL QGQEISQAVP MFQGMMSEAC SVKGGYGLRG YMRTPTTVDG LSATAQECSL  420
TLSTPPAAQV HSPHPNHMFN QTVASQLGLA SKTAGEVGNS SQPRPFEMLW EAQTRSQHGR  480
PGQISLDQFE TRRASAPGDA AKTGSGGREV RKTSCRLFGF SLTEKILPAD DDSVKEVSYE  540
AECQNPRMLD LFGYNRSTPN AALPALCAAP FGM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A7e-7315244157388Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.5G321300.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012701823.10.0auxin response factor 3 isoform X1
SwissprotQ5JMM10.0ARFC_ORYSJ; Auxin response factor 3
TrEMBLA0A368RB280.0A0A368RB28_SETIT; Auxin response factor
STRINGSi000542m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.11e-112ARF family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Song X, et al.
    Rice RNA-dependent RNA polymerase 6 acts in small RNA biogenesis and spikelet development.
    Plant J., 2012. 71(3): p. 378-89
    [PMID:22443269]