PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G321300.2.p
Common NameLOC101782847, SETIT_000545mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family ARF
Protein Properties Length: 683aa    MW: 74565.1 Da    PI: 7.2359
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G321300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.81.1e-24128229199
                         EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                         f+k+lt sd++++g +++p++ ae++       ++ +  s++l+ +d++g +W++++iyr++++r++lt+GW++Fv+ ++L +gD v+F  
  Seita.5G321300.2.p 128 FCKTLTASDTSTHGGFSVPRRAAEDCfppldynQLRP--SQELVAKDLHGAKWKFRHIYRGQPRRHLLTTGWSSFVHKKKLVSGDAVLFL- 215
                         99****************************9876665..459************************************************. PP

                         -SSSEE..EEEEE-S CS
                  B3  85 dgrsefelvvkvfrk 99 
                          + +++el+++v+r+
  Seita.5G321300.2.p 216 -RGDDGELRLGVRRA 229
                         .3489999***9986 PP

2Auxin_resp91.61.4e-30256334382
          Auxin_resp   3 haastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                         ++++++svF++ YnPra++se++++++k+ k+l+++v++G R+ ++  +ed+serr sG+vvg+s++d+v+Wp+SkWrsL
  Seita.5G321300.2.p 256 DSLEHRSVFHISYNPRATASEYIIPYRKFIKSLNRPVCIGARINFQCHNEDVSERR-SGMVVGISEVDSVKWPGSKWRSL 334
                         57899***************************************************.9********************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019368.5E-45112266IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.0E-38123229IPR015300DNA-binding pseudobarrel domain
CDDcd100175.34E-23126228No hitNo description
SMARTSM010193.2E-24128230IPR003340B3 DNA binding domain
PROSITE profilePS5086313.324128230IPR003340B3 DNA binding domain
PfamPF023621.3E-22128229IPR003340B3 DNA binding domain
PfamPF065071.2E-25257334IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 683 aa     Download sequence    Send to blast
MGIDLNMVDV GGEDRRPPLG VCRELWHACA GPVVSLPRRG SLVVYLPQGH LAAAGGGDVT  60
ADLPPHVVCR VADVELCADA ATDEVYARLA LVAEGEAFGR NVRGAGVEGD DDMEDLDAER  120
KSRMLHMFCK TLTASDTSTH GGFSVPRRAA EDCFPPLDYN QLRPSQELVA KDLHGAKWKF  180
RHIYRGQPRR HLLTTGWSSF VHKKKLVSGD AVLFLRGDDG ELRLGVRRAI QLKNEALFED  240
FSSDSAKRHT LSDVYDSLEH RSVFHISYNP RATASEYIIP YRKFIKSLNR PVCIGARINF  300
QCHNEDVSER RSGMVVGISE VDSVKWPGSK WRSLLVRWED GSECNGQDRV SPWEIEIVGG  360
SVSVAHSLSA SSSKRTKLCP QGNLDVPTMW NGCTDSVETG KLPRVLQGQE LMGFRTHRVT  420
CAPQTAEVAK FQSSDASRFL TNARSCMLSG PTSRLAVQNT SFTYQSVGFN ESIGFSEVLQ  480
GQEISQAVPM FQGMMSEACS VKGGYGLRGY MRTPTTVDGL SATAQECSLT LSTPPAAQVH  540
SPHPNHMFNQ TVASQLGLAS KTAGEVGNSS QPRPFEMLWE AQTRSQHGRP GQISLDQFET  600
RRASAPGDAA KTGSGGREVR KTSCRLFGFS LTEKILPADD DSVKEVSYEA ECQNPRMLDL  660
FGYNRSTPNA ALPALCAAPF GM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A2e-952035618353Auxin response factor 1
4ldy_B2e-952035618353Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.5G321300.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969978.10.0auxin response factor 3 isoform X2
SwissprotQ5JMM10.0ARFC_ORYSJ; Auxin response factor 3
TrEMBLK3XF860.0K3XF86_SETIT; Auxin response factor
STRINGSi000542m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.11e-150ARF family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Song X, et al.
    Rice RNA-dependent RNA polymerase 6 acts in small RNA biogenesis and spikelet development.
    Plant J., 2012. 71(3): p. 378-89
    [PMID:22443269]