PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G265200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family ARF
Protein Properties Length: 700aa    MW: 77033.1 Da    PI: 6.5941
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G265200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.84.8e-24157258199
                         EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                         f+k+lt sd++++g +++p++ ae++      +++ + s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+F   
  Seita.5G265200.1.p 157 FCKTLTASDTSTHGGFSVPRRAAEDCfppldySLQRP-SQELVAKDLHGTEWKFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFL-- 244
                         99****************************9966654.569************************************************.. PP

                         SSSEE..EEEEE-S CS
                  B3  86 grsefelvvkvfrk 99 
                         + +++ l+++v+r+
  Seita.5G265200.1.p 245 RGEDGVLRLGVRRA 258
                         34899899999986 PP

2Auxin_resp103.52.5e-34284363282
          Auxin_resp   2 ahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                          +a++t++vF+++YnPr s+seF+++++k+++++++++svGmR +m++e++d+serr++G+++g ++++p  W++SkW+sL
  Seita.5G265200.1.p 284 TEAVATRTVFHIYYNPRLSQSEFIIPYWKFMRSFNQPFSVGMRCRMRYESDDASERRCTGIIIGSREAEP-MWHGSKWKSL 363
                         6899******************************************************************.9*******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019367.59E-42151267IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.6E-39153260IPR015300DNA-binding pseudobarrel domain
CDDcd100178.55E-23155257No hitNo description
PROSITE profilePS5086313.338157259IPR003340B3 DNA binding domain
PfamPF023626.8E-22157258IPR003340B3 DNA binding domain
SMARTSM010197.3E-23157259IPR003340B3 DNA binding domain
PfamPF065071.8E-29284363IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 700 aa     Download sequence    Send to blast
MEPSGAASCG RPAGERAAMA GIDLNTVEEE DEEAETPLGL REGGTVCLDL WHACAGPVAP  60
LPRKGSAVVY LPQGHLEHIG GDAAPAAVPP HVFCRVVDVN LHADDATDEV CARVSLLPED  120
EEAERRARAR AREDEDAARY GEGGGAMRPL ARTPHMFCKT LTASDTSTHG GFSVPRRAAE  180
DCFPPLDYSL QRPSQELVAK DLHGTEWKFR HIYRGQPRRH LLTTGWSAFV NKKKLVSGDA  240
VLFLRGEDGV LRLGVRRAAQ LKNVNLIPAP HNQCSNHRNL GNVTEAVATR TVFHIYYNPR  300
LSQSEFIIPY WKFMRSFNQP FSVGMRCRMR YESDDASERR CTGIIIGSRE AEPMWHGSKW  360
KSLVVRWDDD IECRRSQYGS PWDIELTGSV SGSQAHLSCF HVGSFTNGSV SSDFAGSARF  420
HKVLQGQEFL GFKTHDVTAI SASHATEARN LQDSDERSSY INMSNNIFGV PRFGVRSPAG  480
IPRFPYHCSG FGESQRFQKV LQGQEVFRPF RGGALADVHI RTVGMYQPDG THASSAAYKW  540
PTPQGCDIRH PTKPVLLQAS SPSSVLMFPQ TSSKIPHLEY EYSCLDEDED GRRDRAVPTQ  600
DMGRSNQALS LWPHLVSGEA IDECTVTEKM HSPVSGAEHE SNNESTVENG CKIFGISLAE  660
QVRSCDEADS CNANCNSRLQ PSQSQMQSLG TCWATVSAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A1e-1024639319361Auxin response factor 1
4ldy_B1e-1024639319361Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.5G265200.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin under dark condition. {ECO:0000269|PubMed:17408882}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0690050.0BT069005.1 Zea mays full-length cDNA clone ZM_BFb0119L19 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969490.20.0LOW QUALITY PROTEIN: auxin response factor 2-like
SwissprotQ0JKI90.0ARFB_ORYSJ; Auxin response factor 2
TrEMBLA0A368R9010.0A0A368R901_SETIT; Auxin response factor
STRINGSi004598m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25373580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.11e-150ARF family protein
Publications ? help Back to Top
  1. Khanday I,Yadav SR,Vijayraghavan U
    Rice LHS1/OsMADS1 controls floret meristem specification by coordinated regulation of transcription factors and hormone signaling pathways.
    Plant Physiol., 2013. 161(4): p. 1970-83
    [PMID:23449645]