PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G192400.1.p
Common NameLOC101761118, SETIT_002220mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 328aa    MW: 35589.4 Da    PI: 5.7908
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G192400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.5e-161461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg W++eEde+l++ + ++G g+W+++++  g+ R++k+c++rw +yl
  Seita.5G192400.1.p 14 RGLWSPEEDEKLYNHIIRYGVGCWSSVPKLAGLERCGKSCRLRWINYL 61
                        788*******************************************97 PP

2Myb_DNA-binding50.26.1e-1667110146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg+++++E++l++ ++k+lG++ W+ Ia+ ++ gRt++++k++w++
  Seita.5G192400.1.p  67 RGSFSQQEEDLIISLHKMLGNR-WSQIASQLP-GRTDNEIKNFWNS 110
                         899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-23964IPR009057Homeodomain-like
PROSITE profilePS5129418.404961IPR017930Myb domain
SuperFamilySSF466894.87E-2911108IPR009057Homeodomain-like
SMARTSM007176.8E-131363IPR001005SANT/Myb domain
PfamPF002492.6E-141461IPR001005SANT/Myb domain
CDDcd001671.06E-111761No hitNo description
PROSITE profilePS5129425.29862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.7E-2665116IPR009057Homeodomain-like
SMARTSM007173.6E-1566114IPR001005SANT/Myb domain
PfamPF002499.3E-1567110IPR001005SANT/Myb domain
CDDcd001674.07E-1169109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MGREAAATRP KLRRGLWSPE EDEKLYNHII RYGVGCWSSV PKLAGLERCG KSCRLRWINY  60
LRPDLKRGSF SQQEEDLIIS LHKMLGNRWS QIASQLPGRT DNEIKNFWNS CIKKKLRQRG  120
IDPATHKPLD DDDASAAANN AAEAPRDDCN QLPAATDDHC FAMGGARSDP IAPHSPTVSF  180
DPLSVTNVPA MQGSYGAAHS FRSADNLCDY GGVDVASDAA TYSAYTGGGA DSSSNSNGTW  240
TCGGNVVGGG EPMPHMDMFG RDAAEAAYHQ FDPAKYSPWQ QHEAARLHDG VGGAASFPIR  300
SMSRDLPDSC FDLARSALED EFSVDFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-30101163108B-MYB
1h8a_C1e-291011623128MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPossible transcription activator in response to an external signal. May be involved in the regulation of flavonoid biosynthesis.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.5G192400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794210.0HF679421.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB15 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968898.10.0myb-related protein Hv33
RefseqXP_004968899.10.0myb-related protein Hv33
SwissprotP200279e-80MYB3_HORVU; Myb-related protein Hv33
TrEMBLK3XJZ70.0K3XJZ7_SETIT; Uncharacterized protein
STRINGSi002220m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111643041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.11e-74myb domain protein 86