PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Seita.5G143100.2.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 257aa MW: 28983.8 Da PI: 9.2476 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 99.2 | 1.7e-31 | 37 | 86 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+ Seita.5G143100.2.p 37 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 86 79***********************************************8 PP | |||||||
2 | K-box | 101.9 | 8.8e-34 | 105 | 201 | 4 | 100 |
K-box 4 ssgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 s++ ++e +a+++qqe+akL+ i++Lq+++R ++G+ ++++sl++L+qLe +Lek++ kiR++Knell++++e++qk+e +lq++n++ Seita.5G143100.2.p 105 SNS-GtVAEVNAQHYQQESAKLRGTISSLQNSNRTIMGDAIHTMSLRDLKQLEGRLEKGICKIRARKNELLYAEVEYMQKREMDLQSDNMY 194 233.25999********************************************************************************** PP K-box 94 Lrkklee 100 Lr+k++e Seita.5G143100.2.p 195 LRSKVAE 201 ****986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.3E-41 | 29 | 88 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.221 | 29 | 89 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 9.62E-48 | 30 | 103 | No hit | No description |
SuperFamily | SSF55455 | 4.32E-33 | 30 | 101 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.9E-33 | 31 | 51 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 31 | 85 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 9.8E-27 | 38 | 85 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.9E-33 | 51 | 66 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.9E-33 | 66 | 87 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 9.2E-25 | 114 | 199 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 13.796 | 115 | 205 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048366 | Biological Process | leaf development | ||||
GO:0048440 | Biological Process | carpel development | ||||
GO:0048443 | Biological Process | stamen development | ||||
GO:0048497 | Biological Process | maintenance of floral organ identity | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 257 aa Download sequence Send to blast |
MLNMMTDLSC GPSTVTEQPP APTGSGDKPG RGKIEIKRIE NTTNRQVTFC KRRNGLLKKA 60 YELSVLCDAE VALIVFSSRG RLYEYANNSV KATIERYKKA NSDTSNSGTV AEVNAQHYQQ 120 ESAKLRGTIS SLQNSNRTIM GDAIHTMSLR DLKQLEGRLE KGICKIRARK NELLYAEVEY 180 MQKREMDLQS DNMYLRSKVA ENNERGQPPM NMMGAPSTSE YDHMAPYDSR NFHQVNIMQQ 240 PQHYSHQLQP TTLQLG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3kov_A | 4e-21 | 30 | 116 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3kov_B | 4e-21 | 30 | 116 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3kov_I | 4e-21 | 30 | 116 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3kov_J | 4e-21 | 30 | 116 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3p57_A | 4e-21 | 30 | 116 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3p57_B | 4e-21 | 30 | 116 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3p57_C | 4e-21 | 30 | 116 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3p57_D | 4e-21 | 30 | 116 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3p57_I | 4e-21 | 30 | 116 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3p57_J | 4e-21 | 30 | 116 | 1 | 90 | Myocyte-specific enhancer factor 2A |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the development of floral organs. Acts as C-class protein in association with MADS58. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3) and floral meristem determinacy (whorl 4), but not in the regulation of carpel morphogenesis. Plays a more predominant role in controlling lodicule development and in specifying stamen identity than MADS58. {ECO:0000269|PubMed:11828031, ECO:0000269|PubMed:16326928, ECO:0000269|PubMed:9869408}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00609 | ChIP-seq | Transfer from AT4G18960 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Seita.5G143100.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU960810 | 0.0 | EU960810.1 Zea mays clone 228787 MADS-box transcription factor 3 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004968556.1 | 0.0 | MADS-box transcription factor 3 isoform X1 | ||||
Swissprot | Q40704 | 1e-148 | MADS3_ORYSJ; MADS-box transcription factor 3 | ||||
TrEMBL | A0A368R4S2 | 0.0 | A0A368R4S2_SETIT; Uncharacterized protein | ||||
STRING | Pavir.Ea00226.1.p | 1e-176 | (Panicum virgatum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G18960.1 | 1e-105 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Seita.5G143100.2.p |
Publications ? help Back to Top | |||
---|---|---|---|
|