PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Seita.4G086300.1.p | ||||||||
Common Name | SETIT_008089mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 208aa MW: 22082.9 Da PI: 10.3715 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.5 | 1.3e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT Ed++l+ +vk +G g W+ ++++ g++R++k+c++rw++yl Seita.4G086300.1.p 14 RGAWTSKEDDILAAYVKAHGEGKWREVPQKAGLRRCGKSCRLRWLNYL 61 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 53.4 | 5.9e-17 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+ + eE++l+++++k+lG++ W++Ia++++ gRt++++k++w++ Seita.4G086300.1.p 67 RGNISDEEEDLIIRLHKLLGNR-WSLIAARLP-GRTDNEIKNYWNST 111 7899******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 4.2E-24 | 6 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 18.251 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.07E-29 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.4E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.22E-9 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 25.475 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-24 | 65 | 114 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.7E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.5E-15 | 67 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.45E-12 | 71 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 208 aa Download sequence Send to blast |
MGRRACCAKE GLKRGAWTSK EDDILAAYVK AHGEGKWREV PQKAGLRRCG KSCRLRWLNY 60 LRPNIKRGNI SDEEEDLIIR LHKLLGNRWS LIAARLPGRT DNEIKNYWNS TLGRRAGAGG 120 GGSRVVVFGT PDTGSHSHAT PAASGSCENG AAAHRTDPDS AGSAAGTASA AAAVWAPKAV 180 RCTGRLFFHR DLLEAPPASE TPTAGGV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-26 | 12 | 116 | 5 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Seita.4G086300.1.p |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY135019 | 1e-161 | AY135019.1 Zea mays PL transcription factor (pl) mRNA, pl-W22 allele, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004964937.1 | 1e-148 | anthocyanin regulatory C1 protein | ||||
Swissprot | P10290 | 2e-93 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
TrEMBL | A0A368QS51 | 1e-148 | A0A368QS51_SETIT; Uncharacterized protein | ||||
STRING | Si008089m | 1e-119 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP116 | 37 | 448 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G13540.1 | 1e-56 | myb domain protein 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Seita.4G086300.1.p |