PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G321500.1.p
Common NameLOC101758484, SETIT_021216mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family ARF
Protein Properties Length: 842aa    MW: 92737.9 Da    PI: 6.6918
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G321500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.27.3e-24147248199
                         EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                         f+k+lt sd++++g +++ +++a+e+     +++++ +++l+ +d++g +W++++i+r++++r++l++GW+ Fv+a++L +gD ++F   +
  Seita.3G321500.1.p 147 FCKTLTASDTSTHGGFSVLRRHADEClppldMSQHPPNQELVAKDLHGVEWRFRHIFRGQPRRHLLQSGWSVFVSAKRLVAGDAFIFL--R 235
                         99*****************************555555669************************************************..4 PP

                         SSEE..EEEEE-S CS
                  B3  87 rsefelvvkvfrk 99 
                          +++el+v+v+r+
  Seita.3G321500.1.p 236 GENGELRVGVRRA 248
                         49999*****985 PP

2Auxin_resp1102.5e-36273355183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a+ha++t+s+F+++Y+Pr+s++eFvv+++++ ++lk+++++GmRfkm+fe+e+++e++++Gt+vg+ ++dp+ W +SkWrsLk
  Seita.3G321500.1.p 273 AWHAVNTGSMFTIYYKPRTSPAEFVVSRDRYYESLKQNYTIGMRFKMRFEGEEAAEQKFTGTIVGIGASDPSGWADSKWRSLK 355
                         89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019366.41E-41144276IPR015300DNA-binding pseudobarrel domain
CDDcd100171.28E-21145247No hitNo description
Gene3DG3DSA:2.40.330.102.8E-40145262IPR015300DNA-binding pseudobarrel domain
PfamPF023621.1E-21147248IPR003340B3 DNA binding domain
SMARTSM010197.7E-23147249IPR003340B3 DNA binding domain
PROSITE profilePS5086311.73147249IPR003340B3 DNA binding domain
PfamPF065073.6E-33273355IPR010525Auxin response factor
PROSITE profilePS5174522.5713795IPR000270PB1 domain
SuperFamilySSF542773.14E-9716789No hitNo description
PfamPF023095.2E-6760797IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 842 aa     Download sequence    Send to blast
MAAAAGGGGG GWGGPEAGGG GGGEKDALFV ELWKACAGPV SSIPPLGEKV YYFPQGHIEQ  60
VEASTNQLAE QQGTPLYNLP WKIPCKLMNI ELKAEPDTDE VYAQLTLLPD KKRDENTTTT  120
VESDAAEDEV VPVAPPATNE QLLIHSFCKT LTASDTSTHG GFSVLRRHAD ECLPPLDMSQ  180
HPPNQELVAK DLHGVEWRFR HIFRGQPRRH LLQSGWSVFV SAKRLVAGDA FIFLRGENGE  240
LRVGVRRALR HQTTIPSSVI SSHSMHLGVL ATAWHAVNTG SMFTIYYKPR TSPAEFVVSR  300
DRYYESLKQN YTIGMRFKMR FEGEEAAEQK FTGTIVGIGA SDPSGWADSK WRSLKVRWDE  360
ASAVLRPERV SPWQIEPAAV SPSPVNPLPL RFKRSRSNVN ASPSDMPTVT REVASKVMAD  420
SQQNSLPRAL HSQGRAQLTS RFRDSSDLKS AQDLTMWSSG IEQERNNIAA QTKLSLEGWT  480
QTRRPEGYNQ LSSAFQPLKD AQNPLCSFPS QISGNHSNTW DTVDAHYPTQ QANHNMLPGT  540
WSLMPHNSGF MMNQQNYLSM PEAALPQRAE IAKFSGKSAF TSLQGHGIDR CCSGWIGHNR  600
ASSSLINPRP LVIETDVQKT KGTSFKLFGF PLGSPEKSEP LVSPPSVAYD GKLQTSPSQR  660
NQLDIIEVDD YSDPSKTVKP LDGPQTDSVR ENNHPCPEAT QNVQNKVQSS STRSCKKVHK  720
QGSALGRSID LTKFTCYSEL IAELDQMFDF GGELSSPHKN WMVVFTDNEG DMMLVGDDPW  780
NEFCSMVHKM FIYTREEVER MNPGALSSRS EETLSDSLVR GSGSKEPRGG PSALSLNSEN  840
C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-170173778354Auxin response factor 1
4ldw_A1e-170173778354Auxin response factor 1
4ldw_B1e-170173778354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.3G321500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0665440.0BT066544.1 Zea mays full-length cDNA clone ZM_BFb0026K11 mRNA, complete cds.
GenBankJX4285050.0JX428505.1 Zea mays subsp. mays clone pUT3103 ARF28 ARF type transcription factor mRNA, partial cds.
GenBankKJ7268060.0KJ726806.1 Zea mays clone pUT3124 ARF transcription factor (ARF28) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962662.10.0auxin response factor 24
SwissprotQ2QQX60.0ARFX_ORYSJ; Auxin response factor 24
TrEMBLK3Z3U80.0K3Z3U8_SETIT; Auxin response factor
STRINGSi021216m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP117836111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.40.0auxin response factor 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Li G, et al.
    Rice actin-binding protein RMD is a key link in the auxin-actin regulatory loop that controls cell growth.
    Proc. Natl. Acad. Sci. U.S.A., 2014. 111(28): p. 10377-82
    [PMID:24982173]