PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Seita.3G223400.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 167aa MW: 18848.8 Da PI: 10.9769 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 42.1 | 2e-13 | 76 | 118 | 5 | 48 |
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 T +Ed l + vk+lG + W+ Ia+ ++ R +kqc++rw+++l Seita.3G223400.1.p 76 TLDEDRSLEKHVKKLGEKKWSMIAKNLP-DRIGKQCRERWLNHL 118 789*************************.*************97 PP | |||||||
2 | Myb_DNA-binding | 32.4 | 2.1e-10 | 126 | 157 | 3 | 36 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS- CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRt 36 +WT+ E++ +v +++++G++ W++ a++++ gR Seita.3G223400.1.p 126 AWTEKEEKVIVALHRKHGNK-WAKMAKRIP-GRP 157 8*******************.*********.996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 19.419 | 67 | 122 | IPR017930 | Myb domain |
SMART | SM00717 | 8.4E-10 | 71 | 120 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.6E-19 | 72 | 121 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.26E-12 | 76 | 118 | No hit | No description |
SuperFamily | SSF46689 | 2.04E-22 | 76 | 159 | IPR009057 | Homeodomain-like |
Pfam | PF13921 | 1.5E-13 | 77 | 133 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.1E-14 | 122 | 158 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 9.222 | 123 | 166 | IPR017930 | Myb domain |
SMART | SM00717 | 0.12 | 123 | 164 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.18E-6 | 126 | 156 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 167 aa Download sequence Send to blast |
MSILLGKTMS RKMARFRNKM LPIFRVPAAD GGLGYGGAIC GNHALLGNTV PSENTLVSQV 60 NAEEDARTYN QRGQRTLDED RSLEKHVKKL GEKKWSMIAK NLPDRIGKQC RERWLNHLSP 120 DIKTTAWTEK EEKVIVALHR KHGNKWAKMA KRIPGRPESN FSRSSK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 6e-28 | 72 | 159 | 27 | 114 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the motif 5'-GTAACNT-3' in the promoter of target genes (e.g. DD11 and DD18) and promotes their expression within synergid cells (e.g. in the filiform apparatus) in ovules (PubMed:16214903, PubMed:17693534, PubMed:18410484, PubMed:17937500). Required for the formation of the filiform apparatus during synergid cell differentiation in the female gametophyte (PubMed:16214903). Involved in pollen tube guidance to the micropyle (PubMed:16214903, PubMed:17937500, PubMed:23093426). {ECO:0000269|PubMed:16214903, ECO:0000269|PubMed:17693534, ECO:0000269|PubMed:17937500, ECO:0000269|PubMed:18410484, ECO:0000269|PubMed:23093426}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Seita.3G223400.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004961912.1 | 1e-121 | transcription factor MYB98-like | ||||
Swissprot | Q9S7L2 | 4e-29 | MYB98_ARATH; Transcription factor MYB98 | ||||
TrEMBL | A0A368QHQ1 | 1e-120 | A0A368QHQ1_SETIT; Uncharacterized protein | ||||
STRING | Pavir.J19808.1.p | 2e-34 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP27596 | 4 | 5 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G18770.1 | 2e-31 | myb domain protein 98 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Seita.3G223400.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|