PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G179300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family ARF
Protein Properties Length: 678aa    MW: 74050.2 Da    PI: 7.0534
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G179300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.61.2e-23130231199
                         EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                         f+k+lt sd++++g +++p++ ae++       ++ +  s++l+ +d++g +W++++iyr++++r++lt+GW++F + ++L +gD v+F  
  Seita.3G179300.1.p 130 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyeQLRP--SQELIAKDLHGMKWRFRHIYRGQPRRHLLTTGWSSFINKKKLVSGDAVLFL- 217
                         99****************************9866664..459************************************************. PP

                         -SSSEE..EEEEE-S CS
                  B3  85 dgrsefelvvkvfrk 99 
                          + +++el+++v+r+
  Seita.3G179300.1.p 218 -RGNDGELRLGVRRA 231
                         .4489999****996 PP

2Auxin_resp1033.8e-34256336182
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                         +a++++++s+F++++nPr+++seF+v++ k++k l+ ++s GmRfk+ fe+ed+++r+  G+++g+s++dp+rWp+SkWr+L
  Seita.3G179300.1.p 256 VASSLENRSIFHICFNPRTGASEFIVSYGKFLKGLNYPFSTGMRFKVGFENEDANQRS-HGLISGISEVDPIRWPGSKWRCL 336
                         578899*************************************************999.9*********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.57E-42124261IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.9E-38127232IPR015300DNA-binding pseudobarrel domain
CDDcd100171.37E-21128230No hitNo description
PfamPF023621.3E-21130231IPR003340B3 DNA binding domain
SMARTSM010193.0E-23130232IPR003340B3 DNA binding domain
PROSITE profilePS5086313.07130232IPR003340B3 DNA binding domain
PfamPF065074.1E-28257336IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0010582Biological Processfloral meristem determinacy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 678 aa     Download sequence    Send to blast
MGIDLNAVEE DELAGPAVCG ELWHACAGAG VALPRRGGAV VYLPQAHLAA AGDGGEVPAS  60
AAARVPPHVA CRVVDVELCA DAATDEVYAR LALVAEGKMF GRNNHDRETE VNCEMEDGDG  120
GKKLRTSHMF CKTLTASDTS THGGFSVPRR AAEDCFPPLD YEQLRPSQEL IAKDLHGMKW  180
RFRHIYRGQP RRHLLTTGWS SFINKKKLVS GDAVLFLRGN DGELRLGVRR AVPLKNELLL  240
EAVNSTDSKL RTLSAVASSL ENRSIFHICF NPRTGASEFI VSYGKFLKGL NYPFSTGMRF  300
KVGFENEDAN QRSHGLISGI SEVDPIRWPG SKWRCLLVKW DDDTKCNHRN RVSPWDIEGI  360
SSSISMTNCL SSVSKRTKLC FPQGDLDAPI LDGNGRPDSM ETECFHRVLQ GQELVRTRTH  420
GVAWSHSSDT PKCQGSCERR FSADVWNCKM NDAMSGFRHR NANGFAYQPL GFSESVRFSE  480
VLQGQEMSQA VPSFLGAALD ARVQNGRIGS FDYVHRSTVS QGYPLQQFNL PATEVHSPSS  540
VLMVNQTTAL QPELEGMTNR EEANGSRYAP IAVRREAERW PSTQQPRASG NGSEVFNTTE  600
ASAPATAAKP VDRGVGRSSC RLFGFSLTDK ILGAEEDGVK EGNYEADHQT PRALDLFGHS  660
QSAPSALHAL CAAPLGI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A6e-971736218357Auxin response factor 1
4ldy_B6e-971736218357Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00021PBMTransfer from AT2G33860Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.3G179300.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by auxin under light condition. {ECO:0000269|PubMed:17408882}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961506.10.0auxin response factor 14
SwissprotQ0DGS10.0ARFN_ORYSJ; Auxin response factor 14
TrEMBLA0A368QGL30.0A0A368QGL3_SETIT; Auxin response factor
STRINGSi021589m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51132756
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.11e-154ARF family protein
Publications ? help Back to Top
  1. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]