PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Seita.3G098400.1.p | ||||||||
Common Name | LOC101776842, SETIT_022981mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 265aa MW: 29848.1 Da PI: 9.3196 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 96.4 | 1.2e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++ rqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+ Seita.3G098400.1.p 9 KRIENNTSRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 59 79***********************************************95 PP | |||||||
2 | K-box | 102 | 8.2e-34 | 84 | 175 | 9 | 100 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 le + ++++qqe+akL+++i++Lq+++Rhl+G+++e+LslkeL+qLe++Lek+++kiR++K+ell ++i+++ k+e elq+++++Lr+k+e Seita.3G098400.1.p 84 LELNAQQYYQQESAKLRNQIQMLQNTNRHLVGDSVENLSLKELKQLESRLEKGISKIRARKSELLSAEINYMVKRETELQNDHMNLRNKIE 174 667889************************************************************************************9 PP K-box 100 e 100 e Seita.3G098400.1.p 175 E 175 7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 33.543 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 7.5E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.09E-45 | 2 | 78 | No hit | No description |
SuperFamily | SSF55455 | 1.57E-32 | 2 | 74 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.6E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.6E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.6E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.6E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 3.5E-24 | 87 | 173 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.018 | 89 | 179 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048283 | Biological Process | indeterminate inflorescence morphogenesis | ||||
GO:0048316 | Biological Process | seed development | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0080155 | Biological Process | regulation of double fertilization forming a zygote and endosperm | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 265 aa Download sequence Send to blast |
MGRGRIEIKR IENNTSRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRLYEYSNN 60 SVKATIERYK KAHAVGSSSG PPLLELNAQQ YYQQESAKLR NQIQMLQNTN RHLVGDSVEN 120 LSLKELKQLE SRLEKGISKI RARKSELLSA EINYMVKRET ELQNDHMNLR NKIEEGEQQL 180 QQVTVARSAA AAAASVELNP FLQMDTKCFF PAGPFAALDM KCFFPGGLQM LEAHRQMLTT 240 ELNLGYQLAP APSDDAVNNP HQLF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 2e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
5f28_A | 3e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 3e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 3e-19 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 3e-19 | 1 | 69 | 1 | 69 | MEF2C |
6c9l_A | 2e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-19 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Seita.3G098400.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | ZMU31522 | 0.0 | U31522.1 Zea Mays MADS box protein (ZmOV23) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004960786.1 | 0.0 | MADS-box transcription factor 13 | ||||
Swissprot | Q2QW53 | 1e-123 | MAD13_ORYSJ; MADS-box transcription factor 13 | ||||
TrEMBL | K3Z8W1 | 0.0 | K3Z8W1_SETIT; Uncharacterized protein | ||||
STRING | Si022981m | 0.0 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP649 | 37 | 144 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G42830.1 | 2e-82 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Seita.3G098400.1.p |
Entrez Gene | 101776842 |