PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 676791654 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 218aa MW: 25300.4 Da PI: 9.892 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 89.8 | 1.4e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien + rqvtfskRr g++KKA+ELSvLCda+va i+fs++g+lye+ss 676791654 9 KKIENVTSRQVTFSKRRSGLFKKAHELSVLCDAQVAAIVFSQSGRLYEFSS 59 68***********************************************96 PP | |||||||
2 | K-box | 62.4 | 1.7e-21 | 88 | 171 | 14 | 97 |
K-box 14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 ++l++e++ + k+i+ L+ qR+l+G++L+s+s+ eLq++ q+eksl+ +Rs+K el+ +q++ l++ke+el +e ++Lr+k 676791654 88 LQELKKEMDIMVKKIDLLEVHQRKLMGQGLGSCSVAELQEIDIQIEKSLRIVRSRKAELYADQLRGLKQKERELLDERRRLREK 171 6899******************************************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.9E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.581 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 4.97E-32 | 3 | 78 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 5.38E-42 | 3 | 74 | No hit | No description |
PRINTS | PR00404 | 3.6E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.9E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.6E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.6E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 13.171 | 88 | 179 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.3E-20 | 89 | 171 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 218 aa Download sequence Send to blast |
MVRGKIEIKK IENVTSRQVT FSKRRSGLFK KAHELSVLCD AQVAAIVFSQ SGRLYEFSSS 60 EMEKTIERYG KFSNEYFVPG RLQVELYLQE LKKEMDIMVK KIDLLEVHQR KLMGQGLGSC 120 SVAELQEIDI QIEKSLRIVR SRKAELYADQ LRGLKQKERE LLDERRRLRE KEIRERLLRP 180 VLPVTLHAEK GEPEGGCRTK HSTEVETDLF IGLPVARL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 4e-19 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 4e-19 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 4e-19 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 4e-19 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 4e-19 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 4e-19 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 4e-19 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 4e-19 | 1 | 73 | 1 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL42 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 676791654 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY141220 | 1e-160 | AY141220.1 Arabidopsis thaliana MADS-box protein AGL71 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018454345.1 | 1e-140 | PREDICTED: MADS-box protein AGL71 | ||||
Refseq | XP_018454346.1 | 1e-140 | PREDICTED: MADS-box protein AGL71 | ||||
Refseq | XP_018454347.1 | 1e-140 | PREDICTED: MADS-box protein AGL71 | ||||
Swissprot | Q9LT93 | 1e-113 | AGL71_ARATH; MADS-box protein AGL71 | ||||
TrEMBL | A0A397XIY7 | 1e-130 | A0A397XIY7_BRACM; Uncharacterized protein | ||||
STRING | XP_006281070.1 | 1e-125 | (Capsella rubella) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G51870.3 | 1e-108 | AGAMOUS-like 71 |