PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 676772242 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 122aa MW: 14029.9 Da PI: 9.3043 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 30.4 | 1e-09 | 12 | 51 | 2 | 41 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTH CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvL 41 Fl++ly+i+++++++++ sws++g+sfvv++ +e++++vL 676772242 12 FLNRLYNIVDNPATDSIASWSQSGKSFVVWNLDELTRDVL 51 9************************************998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00415 | 3.9E-10 | 10 | 103 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene3D | G3DSA:1.10.10.10 | 1.6E-12 | 10 | 102 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 1.63E-12 | 12 | 102 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Pfam | PF00447 | 1.8E-9 | 12 | 102 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
MVEIGRNIDE VFLNRLYNIV DNPATDSIAS WSQSGKSFVV WNLDELTRDV LFGVSGPLEF 60 TIPSILCICG YRFRRVGHPP RTELANDNFV RGQRQLMKNI PRPGKEPIQK QQNQKENSNQ 120 RN |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 676772242 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
TrEMBL | V4NBE5 | 3e-35 | V4NBE5_EUTSA; Uncharacterized protein | ||||
STRING | XP_006401778.1 | 4e-36 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM19542 | 5 | 6 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G18870.1 | 7e-18 | HSF family protein |