PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 676759432 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 232aa MW: 26915.2 Da PI: 8.3092 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.1 | 1.8e-17 | 18 | 65 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT eEd +l d+v+ +G+g+W++I r+ g++R++k+c++rw +yl 676759432 18 KGLWTVEEDNILMDYVHTHGKGQWNRIVRKTGLKRCGKSCRLRWINYL 65 678*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 62.2 | 1e-19 | 71 | 116 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g++T++E++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l 676759432 71 KGNFTEQEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNHWNTHL 116 79********************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.631 | 13 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 7.05E-31 | 16 | 112 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.9E-14 | 17 | 67 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.5E-15 | 18 | 65 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.9E-24 | 19 | 72 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.05E-11 | 21 | 65 | No hit | No description |
PROSITE profile | PS51294 | 29.281 | 66 | 120 | IPR017930 | Myb domain |
SMART | SM00717 | 6.1E-19 | 70 | 118 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-18 | 71 | 116 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.19E-14 | 73 | 116 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.1E-27 | 73 | 121 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0001708 | Biological Process | cell fate specification | ||||
GO:0032880 | Biological Process | regulation of protein localization | ||||
GO:0048629 | Biological Process | trichome patterning | ||||
GO:2000039 | Biological Process | regulation of trichome morphogenesis | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 232 aa Download sequence Send to blast |
MKTRRRTEEG ENHQEYKKGL WTVEEDNILM DYVHTHGKGQ WNRIVRKTGL KRCGKSCRLR 60 WINYLSPNVN KGNFTEQEED LIIRLHKLLG NRWSLIAKRV PGRTDNQVKN HWNTHLSKKI 120 VRYYSSAVKT PGEYDTSPSL FITPATTSRH NQQDKVCVKS FDGPELASYE NKPKADLIES 180 NVEMGNINDP SLYVNERNTF DSSNAFWVNE DEFELSSFAM MDFASGDIGY CL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-28 | 18 | 120 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in leaves. Together with TTG1 and GL3, promotes trichome formation and endoreplication. Regulates the production of a signal that induces hair (trichome) precursor cells on leaf primordia to differentiate. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes (By similarity). {ECO:0000250, ECO:0000269|PubMed:11063707, ECO:0000269|PubMed:12356720, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15728674, ECO:0000269|PubMed:9625690}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 676759432 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by gibberellins (PubMed:9625690). May be regulated by GEBP and GEBP-like proteins (PubMed:12535344). {ECO:0000269|PubMed:12535344, ECO:0000269|PubMed:9625690}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HQ292618 | 0.0 | HQ292618.1 Brassica rapa subsp. rapa cultivar Tsuda MYB domain protein 0 (MYB0) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018482055.1 | 1e-137 | PREDICTED: trichome differentiation protein GL1 | ||||
Swissprot | P27900 | 1e-113 | GL1_ARATH; Trichome differentiation protein GL1 | ||||
TrEMBL | A0A397Z9X4 | 1e-131 | A0A397Z9X4_BRACM; Uncharacterized protein | ||||
TrEMBL | E2JCB6 | 1e-131 | E2JCB6_BRACM; Glabra 1 (Fragment) | ||||
STRING | Bra025311.1-P | 1e-129 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27920.1 | 1e-116 | myb domain protein 0 |