PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676749180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family ARF
Protein Properties Length: 591aa    MW: 66377.5 Da    PI: 6.4564
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676749180genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.91.9e-23127227198
                EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                f+k+lt sd++++g +++ +k+a+e+       +   + +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv++++L +gD +vF   + +++ l+
  676749180 127 FVKILTASDTSTHGGFSVLRKHATEClpaldmtQ--ATPTQELVARDLHGMEWRFKHIFRGQPRRHLLTTGWSTFVSSKRLVAGDAFVFL--RGENGDLR 222
                89****************************9543..445569************************************************..3488889* PP

                EEEE- CS
         B3  94 vkvfr 98 
                v+v+r
  676749180 223 VGVRR 227
                **998 PP

2Auxin_resp94.41.8e-31253332183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a+ha+ ++++F v+Y+Pr   s+F+v v+k+++a+k+ +++G+Rf+m+fe+e+s+er ++Gt+vg+ dl++ +W+ S WrsL+
   676749180 253 ASHAVVSQTMFLVFYKPRI--SQFIVGVNKYMEAMKHGFTLGTRFRMRFEGEESPERIFTGTIVGIGDLSS-QWRASTWRSLQ 332
                 68999*************8..9**********************************************777.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.7E-40112256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.0E-39121242IPR015300DNA-binding pseudobarrel domain
CDDcd100171.66E-20125227No hitNo description
SMARTSM010192.7E-22127229IPR003340B3 DNA binding domain
PfamPF023621.6E-21127227IPR003340B3 DNA binding domain
PROSITE profilePS5086312.294127229IPR003340B3 DNA binding domain
PfamPF065076.9E-29253332IPR010525Auxin response factor
PfamPF023097.1E-13481572IPR033389AUX/IAA domain
SuperFamilySSF542775.0E-12483563No hitNo description
PROSITE profilePS5174524.155487579IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 591 aa     Download sequence    Send to blast
MANVDGDDFT TSLSRSYNDQ LYTELWKACA GPLVEVPLAG ERVFYFPQGH MEQLVASTNQ  60
GIESEKIPDF NLPPKILCRV LSVMLKAEHE TDEVYAQITL KPEEEQSEPT SLDPPVVEPT  120
KQMFHSFVKI LTASDTSTHG GFSVLRKHAT ECLPALDMTQ ATPTQELVAR DLHGMEWRFK  180
HIFRGQPRRH LLTTGWSTFV SSKRLVAGDA FVFLRGENGD LRVGVRRLAR HQNTMPTSVI  240
SSQSMHLGVL ATASHAVVSQ TMFLVFYKPR ISQFIVGVNK YMEAMKHGFT LGTRFRMRFE  300
GEESPERIFT GTIVGIGDLS SQWRASTWRS LQVQWDEPTT VQRPDKVSPW EIEPFLPTSP  360
VSTPAQQSQP KCKRSRPVET AVLTPAQASF LYSFPQSQDP TNASLKLSQD PSTERNLGGF  420
ATNNSFKAET PPPASCCYRL FGFDLTSNPP APIPPDKHPM DTCGAVKCQD PITPTSANEP  480
KKQQTSRTRT KVQMQGIAVG RAVDLTLLKS YNELVKELEE MFEIQGQLLP RDRWIVVFTD  540
DEGDMMLAGD DPWNEFCKMA KKIFIYSSDE VKKMTTKMKT SSSLENEESM E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1651835516355Auxin response factor 1
4ldw_A1e-1651835516355Auxin response factor 1
4ldw_B1e-1651835516355Auxin response factor 1
4ldx_A1e-1651835516355Auxin response factor 1
4ldx_B1e-1651835516355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap676749180
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3347170.0AF334717.1 Arabidopsis thaliana auxin response factor ARF18 (At3g61830) mRNA, complete cds.
GenBankAY0597460.0AY059746.1 Arabidopsis thaliana auxin response factor ARF18 (At3g61830) mRNA, complete cds.
GenBankAY0704630.0AY070463.1 Arabidopsis thaliana AT3g61830/F15G16_220 mRNA, complete cds.
GenBankAY0913920.0AY091392.1 Arabidopsis thaliana putative auxin response factor protein (At3g61830) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006402437.10.0auxin response factor 18
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLV4L0T80.0V4L0T8_EUTSA; Auxin response factor
STRINGXP_006402437.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM74351841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61830.10.0auxin response factor 18
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]