PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 676731724 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 176aa MW: 19203.3 Da PI: 6.9472 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 183.9 | 1.2e-57 | 30 | 127 | 1 | 98 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegekk 98 vreqdrflPian+srimk+ lPan+ki+kdaket+qecvsefisf+tseasdkcqrekrktingddllwa++tlGfedyveplk+yl kyre+eg++k 676731724 30 VREQDRFLPIANISRIMKRGLPANGKIAKDAKETMQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMTTLGFEDYVEPLKLYLIKYREMEGDNK 127 69*********************************************************************************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 8.3E-55 | 27 | 143 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.5E-41 | 33 | 157 | IPR009072 | Histone-fold |
Pfam | PF00808 | 5.3E-28 | 36 | 100 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.4E-21 | 64 | 82 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 67 | 83 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 2.4E-21 | 83 | 101 | No hit | No description |
PRINTS | PR00615 | 2.4E-21 | 102 | 120 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 176 aa Download sequence Send to blast |
MADSQAKSSP GGGGGSHESG GEQSPRSLNV REQDRFLPIA NISRIMKRGL PANGKIAKDA 60 KETMQECVSE FISFITSEAS DKCQREKRKT INGDDLLWAM TTLGFEDYVE PLKLYLIKYR 120 EMEGDNKGSG KGGESSAKRD GQPSQFPQHG HQGSFSQGPY GNSQGSHMMV QMPNAE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 5e-49 | 30 | 121 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 5e-49 | 30 | 121 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 676731724 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK176827 | 1e-136 | AK176827.1 Arabidopsis thaliana mRNA for transcription factor NF-Y, CCAAT-binding - like protein, complete cds, clone: RAFL25-38-H16. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018493235.1 | 1e-103 | PREDICTED: nuclear transcription factor Y subunit B-10 | ||||
Swissprot | Q67XJ2 | 1e-100 | NFYBA_ARATH; Nuclear transcription factor Y subunit B-10 | ||||
TrEMBL | V4NG96 | 1e-101 | V4NG96_EUTSA; Uncharacterized protein | ||||
STRING | XP_006403703.1 | 1e-102 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1480 | 27 | 94 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53340.1 | 1e-89 | nuclear factor Y, subunit B10 |
Publications ? help Back to Top | |||
---|---|---|---|
|