PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 676721204 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 80aa MW: 9106.29 Da PI: 4.8899 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 71.4 | 1.7e-22 | 15 | 68 | 2 | 55 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHH CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvR 55 Fl+k+y++++d+++++++sw+e+g++fvv+++ efak++Lp+yFkh+nf+SF+R 676721204 15 FLSKTYQLVDDQSTDDVVSWNEDGTAFVVWKTAEFAKDLLPQYFKHNNFSSFIR 68 9****************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 3.7E-24 | 7 | 68 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 4.7E-17 | 11 | 80 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
SuperFamily | SSF46785 | 2.18E-19 | 12 | 69 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
PRINTS | PR00056 | 3.7E-13 | 15 | 38 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 6.3E-19 | 15 | 68 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 3.7E-13 | 53 | 65 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 80 aa Download sequence Send to blast |
MTAVMVAQRS VPAPFLSKTY QLVDDQSTDD VVSWNEDGTA FVVWKTAEFA KDLLPQYFKH 60 NNFSSFIRFP ENCPGQMGVR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1hks_A | 2e-15 | 10 | 68 | 3 | 60 | HEAT-SHOCK TRANSCRIPTION FACTOR |
1hkt_A | 2e-15 | 10 | 68 | 3 | 60 | HEAT-SHOCK TRANSCRIPTION FACTOR |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 676721204 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:9645433}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC232512 | 4e-82 | AC232512.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB065B14, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_195416.1 | 2e-39 | heat shock factor 4 | ||||
Refseq | XP_013722981.1 | 9e-40 | heat stress transcription factor B-1-like | ||||
Refseq | XP_018472168.1 | 2e-39 | PREDICTED: heat stress transcription factor B-1 | ||||
Refseq | XP_020874746.1 | 3e-39 | heat stress transcription factor B-1 | ||||
Swissprot | Q96320 | 2e-40 | HSFB1_ARATH; Heat stress transcription factor B-1 | ||||
TrEMBL | A0A1J3JZ93 | 5e-38 | A0A1J3JZ93_NOCCA; Heat stress transcription factor B-1 | ||||
TrEMBL | A8IXQ2 | 5e-38 | A8IXQ2_BRACM; Heat shock factor 4 | ||||
TrEMBL | J7FYU6 | 3e-40 | J7FYU6_ARATH; Truncated heat shock factor B1 | ||||
STRING | AT4G36990.1 | 8e-39 | (Arabidopsis thaliana) | ||||
STRING | fgenesh2_kg.7__342__AT4G36988.1 | 1e-38 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM965 | 28 | 111 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G36990.1 | 8e-43 | heat shock factor 4 |